DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9135 and tag-229

DIOPT Version :9

Sequence 1:NP_001285655.1 Gene:CG9135 / 33850 FlyBaseID:FBgn0031769 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001021670.1 Gene:tag-229 / 3565487 WormBaseID:WBGene00044065 Length:200 Species:Caenorhabditis elegans


Alignment Length:104 Identity:23/104 - (22%)
Similarity:41/104 - (39%) Gaps:26/104 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   402 IGCANTSIMISADDTLIAWG----ASPTFGELGIGEFQKSSTVP----------KEVPKL----- 447
            :|...|...::....:|.|.    |...|.::..||.:..:|.|          :..|:|     
 Worm    94 VGDVITHTKLNFRGVIIGWDEHAIAPEKFLKVAHGENKNYATQPNYAVLIDTRDRLTPQLSYIVQ 158

  Fly   448 DNIKIPQVTMGYSHTVLLVDTTHEA---TKQKYEKMPEY 483
            :|::|.:.|:.:.    |||...:.   .:|||...|.|
 Worm   159 ENLEIDKGTVMHP----LVDKFFDGFDEKRQKYIMRPLY 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9135NP_001285655.1 RCC1 139..184 CDD:278826
RCC1_2 171..200 CDD:290274
RCC1 188..236 CDD:278826
RCC1 239..312 CDD:278826
RCC1 317..366 CDD:278826
RCC1 414..465 CDD:278826 13/69 (19%)
tag-229NP_001021670.1 YccV-like 89..186 CDD:382598 18/95 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.