DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9135 and Rcbtb2

DIOPT Version :9

Sequence 1:NP_001285655.1 Gene:CG9135 / 33850 FlyBaseID:FBgn0031769 Length:487 Species:Drosophila melanogaster
Sequence 2:XP_038949091.1 Gene:Rcbtb2 / 290363 RGDID:735048 Length:585 Species:Rattus norvegicus


Alignment Length:296 Identity:70/296 - (23%)
Similarity:127/296 - (42%) Gaps:37/296 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 EQLNIVQAA----VGRHHTLFLTDTGTVYACGENKSGQCGVGNTHANIYSPTPINYRGPPIIRIG 227
            |:|.:::.|    ...:..|:.|....::..|.|.||..|||:..:.|......:..|..|..:.
  Rat    74 EELQLIRQACVFGTAGNEVLYTTVNDEIFVLGTNCSGCLGVGDIQSTIEPRRLDSLTGKKIASLS 138

  Fly   228 CGAEFSVIL-DIKGSLHTFGLPEYGQLGHNTDAKYFVNANKLSFHFETSPKKVVLYIEKSKEGHV 291
            .|:...::| ...|.:.|:|...|.|||:.|     .|...:..|..|:                
  Rat   139 YGSGPHIVLATTDGEVFTWGHNAYSQLGNGT-----TNHGLVPCHISTN---------------- 182

  Fly   292 TPVDGVQIVDFACGNNHTVAIDSKKRVYSWGFGGFGRLGHAEPKDEMVPRLMKFFDTQGRGGRSV 356
              :...|:::.|||:.|::.:.|...|::||:...|::|.....::.:||.:... .|.:...|:
  Rat   183 --LSNKQVIEVACGSYHSLVLTSDGEVFAWGYNNSGQVGSGSTANQPIPRRVTGC-LQNKVVMSI 244

  Fly   357 FCGSTFSLIVNELGLLFLFGQNKK----TGEANMYPKP--VQDLSGWNITDIGCANTSIMISADD 415
            .||...|:.|.:.|.::::|.|..    .|.:...|.|  |..|.|..:..:.|.....::..|:
  Rat   245 ACGQMCSMAVVDTGEVYVWGYNGNGQLGLGSSGNQPTPCRVAALQGIRVQRVACGYAHTLVLTDE 309

  Fly   416 -TLIAWGASPTFGELGIGEFQKSSTVPKEVPKLDNI 450
             .:.||||: ::|:||.|.....|.....|.:.|.|
  Rat   310 GQIYAWGAN-SYGQLGTGNKSNQSYPTPVVVEKDRI 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9135NP_001285655.1 RCC1 139..184 CDD:278826 4/20 (20%)
RCC1_2 171..200 CDD:290274 6/32 (19%)
RCC1 188..236 CDD:278826 11/47 (23%)
RCC1 239..312 CDD:278826 16/72 (22%)
RCC1 317..366 CDD:278826 12/48 (25%)
RCC1 414..465 CDD:278826 13/38 (34%)
Rcbtb2XP_038949091.1 ATS1 <141..421 CDD:227511 54/229 (24%)
BTB_POZ_RCBTB2_CHC1L 408..524 CDD:349663
BACK_RCBTB2 521..585 CDD:350604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.