DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9135 and Zzef1

DIOPT Version :9

Sequence 1:NP_001285655.1 Gene:CG9135 / 33850 FlyBaseID:FBgn0031769 Length:487 Species:Drosophila melanogaster
Sequence 2:XP_006246919.1 Gene:Zzef1 / 287476 RGDID:1311189 Length:2965 Species:Rattus norvegicus


Alignment Length:296 Identity:58/296 - (19%)
Similarity:100/296 - (33%) Gaps:65/296 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AGGNGAGPNKRRPKKKESDYEDEFSDESDDDGVQQQAAAANQMEVLIPHDDLDPPSKLPEDLLAT 71
            |||.|..|           ::|..:|.....|....||.......|:      .|::|.|...|.
  Rat    16 AGGEGWSP-----------HQDWAADSGATPGPGPAAAVLPSAAALL------EPARLREAAAAL 63

  Fly    72 LEKTPGQMLIA----GMVTW--DLTGKRDRKNVT--------KVRPNLYSFHRFTEEKYRYVASG 122
            ....|.:.|::    .::.|  :..| |..::||        :.|....|..:|.|...::.|.|
  Rat    64 RPAPPCESLVSRHHGALLRWLEERLG-RGEESVTLEQFRELLEARGAGCSGEQFEEAFAQFDAEG 127

  Fly   123 PSA--AHTILINMDRKALGFGRNPSGQLGLSQDIKLAEKPTIIPA-LEQLNIVQAAVGRHHTLFL 184
            ...  |..:|..:...:   |.|..|:  ||..|:..:..:::|. ::..:..:..:|.|.::.|
  Rat   128 DGTVDAENMLEALKNSS---GANLQGE--LSHVIRQLQACSLVPGFIDIFSESKEGLGTHSSMIL 187

  Fly   185 TDTGTVYACGENKSGQCGVGNTHANIYSPTPINYRGPPII---RIGCGAEFSVILDIKGSLHTFG 246
            .                   ..|.|..|...|.|   |::   ...|....||:.|....|....
  Rat   188 R-------------------FLHRNRVSSMVIPY---PMLDHCNNMCTMRSSVLKDSLDQLLQKE 230

  Fly   247 LPEYGQLGHNTDAKYFVNANKLSFHFETSPKKVVLY 282
            ....|.|..:.:.....:..|...:.|||.....:|
  Rat   231 KESPGDLARSPEMDKLKSVTKCYAYIETSSNPADIY 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9135NP_001285655.1 RCC1 139..184 CDD:278826 9/45 (20%)
RCC1_2 171..200 CDD:290274 3/28 (11%)
RCC1 188..236 CDD:278826 9/50 (18%)
RCC1 239..312 CDD:278826 8/44 (18%)
RCC1 317..366 CDD:278826
RCC1 414..465 CDD:278826
Zzef1XP_006246919.1 EFh <94..141 CDD:238008 10/46 (22%)
APC10-ZZEF1 250..380 CDD:176488 5/17 (29%)
CUB <1119..1189 CDD:294042
ZZ_EF 1779..1826 CDD:239083
ZZ 1828..1875 CDD:239069
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.