DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9135 and NEK8

DIOPT Version :9

Sequence 1:NP_001285655.1 Gene:CG9135 / 33850 FlyBaseID:FBgn0031769 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_835464.1 Gene:NEK8 / 284086 HGNCID:13387 Length:692 Species:Homo sapiens


Alignment Length:264 Identity:71/264 - (26%)
Similarity:114/264 - (43%) Gaps:46/264 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 YRYVASGPSAAHTILINMDRKALGFGRNPSGQLGLS--QDIKLAEKPTIIPALEQLNIVQAAVGR 178
            |..|.....|:|.:.::.:|:...:||..||:|||.  :.....::..:.|..|...:|   .|.
Human   443 YEMVQVACGASHVLALSTERELFAWGRGDSGRLGLGTRESHSCPQQVPMPPGQEAQRVV---CGI 504

  Fly   179 HHTLFLTDTGTVYACGENKSGQCGVGN--------THANIYSPTPINYRG------PPIIRIGCG 229
            ..::.||..|...|||.|:..:.|:.:        .|..:.........|      .|::.|..|
Human   505 DSSMILTVPGQALACGSNRFNKLGLDHLSLGEEPVPHQQVEEALSFTLLGSAPLDQEPLLSIDLG 569

  Fly   230 AEFSVILDIKGSLHTFGLPEYGQLGHNTDAKYFVNANKLSFHFETSPKKVVLYIEKSKEGHVTPV 294
            ...|..:...|..:|||..::||||.||.            ....:|.||        :|    :
Human   570 TAHSAAVTASGDCYTFGSNQHGQLGTNTR------------RGSRAPCKV--------QG----L 610

  Fly   295 DGVQIVDFACGNNHTVAIDSKKRVYSWGFGGFGRLGHAEPKDEMVPRLMKFFDTQGRGGRSVFC- 358
            :|:::...|||:..||||.::..|||||.|..||||..: :|..:||.::..:|......||.| 
Human   611 EGIKMAMVACGDAFTVAIGAESEVYSWGKGARGRLGRRD-EDAGLPRPVQLDETHPYTVTSVSCC 674

  Fly   359 -GST 361
             |:|
Human   675 HGNT 678

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9135NP_001285655.1 RCC1 139..184 CDD:278826 11/46 (24%)
RCC1_2 171..200 CDD:290274 9/28 (32%)
RCC1 188..236 CDD:278826 12/61 (20%)
RCC1 239..312 CDD:278826 20/72 (28%)
RCC1 317..366 CDD:278826 19/47 (40%)
RCC1 414..465 CDD:278826
NEK8NP_835464.1 STKc_Nek8 3..258 CDD:270859
RCC1 276..657 CDD:332518 64/241 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 277..301
RCC1 1 312..350
RCC1 2 410..461 4/17 (24%)
RCC1 3 462..513 14/53 (26%)
RCC1 4 580..631 22/74 (30%)
RCC1 5 632..684 19/48 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.