DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9135 and HECTD4

DIOPT Version :10

Sequence 1:NP_608985.1 Gene:CG9135 / 33850 FlyBaseID:FBgn0031769 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001103132.4 Gene:HECTD4 / 283450 HGNCID:26611 Length:4428 Species:Homo sapiens


Alignment Length:127 Identity:29/127 - (22%)
Similarity:45/127 - (35%) Gaps:16/127 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 LQDKRSTSGSWRFADECRLRDGTDRHRNRSVQLTSRECSIISKIIKRKCTYNVAEAHGPKRPAKV 145
            |..:..|...|..|  |:.|....|...::.:.|::   .|..:..||.|..:.:....|:....
Human     6 LDPENPTKCKWTGA--CKSRGSNLRVHFKNTRETAQ---AIKGMHIRKATKYLKDVTLQKQCVPF 65

  Fly   146 GRRKGNRTRSKGRRCRAMQCRVCSSLQGEGKNVASKFARNRELRTAKNRTGNKRIKSWKNDS 207
            .|..|    ..||..:|.|   ....||.....:::|.    |...||...|..:|....||
Human    66 RRYNG----GVGRCAQAKQ---WGWTQGRWPKKSAEFL----LHMLKNAESNAELKGLDVDS 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9135NP_608985.1 ATS1 119..469 CDD:444065 21/89 (24%)
HECTD4NP_001103132.4 SPRY_HECT_like 2409..2564 CDD:293970
HECTc 4029..4423 CDD:238033
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.