DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9135 and K11D2.1

DIOPT Version :9

Sequence 1:NP_001285655.1 Gene:CG9135 / 33850 FlyBaseID:FBgn0031769 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001368497.1 Gene:K11D2.1 / 187290 WormBaseID:WBGene00010768 Length:278 Species:Caenorhabditis elegans


Alignment Length:224 Identity:54/224 - (24%)
Similarity:80/224 - (35%) Gaps:76/224 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 NTHAN-IYSPTPINYRGPPIIRIGCGAEFSVILDIKGSLHTFGLPEYGQLGHNTDAKYFVNANKL 268
            |..|| |..|.|:.     |:....|.:|.:..|..|:|.:.|....|:||              
 Worm   119 NNLANKIQFPWPVR-----IVEAAAGHDFLIFRDTTGNLFSMGTGTRGELG-------------- 164

  Fly   269 SFHFETSPKKVVLYIEKSKEGHVTPVDGVQIVDFACGNNHTVAIDSKKRVYSWGFGGFGRLGHAE 333
                      |.|.....:..|:..:.|::|...|||..||||:......|:||:..:|:||   
 Worm   165 ----------VGLIRRVDEPVHIEQLVGIRIKKVACGGWHTVALTEGGDAYTWGWNRYGQLG--- 216

  Fly   334 PKDEMVPRLMKFFDTQGRGGRSVFCGSTFSLIVNELGLLFLFGQNKKTGEANMYPKPVQDLSGWN 398
             ||:                     |||      |:..:.:..:.:|.||.             |
 Worm   217 -KDK---------------------GST------EVYPVLIDPEEEKFGEE-------------N 240

  Fly   399 ITDIGCA--NTSIMISADDTLIAWGASPT 425
            |.|:.|.  ||.|:|.........|.:||
 Worm   241 ILDVACTEHNTQIVIKTGHAPFVLGTNPT 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9135NP_001285655.1 RCC1 139..184 CDD:278826
RCC1_2 171..200 CDD:290274
RCC1 188..236 CDD:278826 9/31 (29%)
RCC1 239..312 CDD:278826 17/72 (24%)
RCC1 317..366 CDD:278826 11/48 (23%)
RCC1 414..465 CDD:278826 3/12 (25%)
K11D2.1NP_001368497.1 ATS1 <118..>259 CDD:227511 51/212 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.