DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9135 and Nek8

DIOPT Version :9

Sequence 1:NP_001285655.1 Gene:CG9135 / 33850 FlyBaseID:FBgn0031769 Length:487 Species:Drosophila melanogaster
Sequence 2:XP_006532246.1 Gene:Nek8 / 140859 MGIID:1890646 Length:702 Species:Mus musculus


Alignment Length:267 Identity:70/267 - (26%)
Similarity:116/267 - (43%) Gaps:52/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 YRYVASGPSAAHTILINMDRKALGFGRNPSGQLGLS--QDIKLAEKPTIIPALEQLNIVQAAVGR 178
            |..|.....|:|.:.::.|.:...:||...|:|||.  :.....::..:.|..|...:|   .|.
Mouse   449 YEMVQVACGASHVLALSTDGELFAWGRGDGGRLGLGTRESHNCPQQVPVAPGQEAQRVV---CGI 510

  Fly   179 HHTLFLTDTGTVYACGENKSGQCGVGNTHANIYSPTPINYR-------------GP----PIIRI 226
            ..::.||..|.|.|||.|:..:.|:  .|.:: ...|:.|:             .|    |::.:
Mouse   511 DSSMILTSPGRVLACGSNRFNKLGL--DHLSL-DEEPVPYQQVEEALSFTPLGSAPLDQEPLLCV 572

  Fly   227 GCGAEFSVILDIKGSLHTFGLPEYGQLGHNTDAKYFVNANKLSFHFETSPKKVVLYIEKSKEGHV 291
            ..|...|..:...|..:|||..::||||                   ||.::|     ......|
Mouse   573 DLGTAHSAAITASGDCYTFGSNQHGQLG-------------------TSSRRV-----SRAPCRV 613

  Fly   292 TPVDGVQIVDFACGNNHTVAIDSKKRVYSWGFGGFGRLGHAEPKDEMVPRLMKFFDTQGRGGRSV 356
            ..::|:::|..|||:..|||:.::..|||||.|..||||..: :|..:||.::..:|......||
Mouse   614 QGLEGIKMVMVACGDAFTVAVGAEGEVYSWGKGTRGRLGRRD-EDAGLPRPVQLDETHPYMVTSV 677

  Fly   357 FC--GST 361
            .|  |:|
Mouse   678 SCCHGNT 684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9135NP_001285655.1 RCC1 139..184 CDD:278826 10/46 (22%)
RCC1_2 171..200 CDD:290274 10/28 (36%)
RCC1 188..236 CDD:278826 14/64 (22%)
RCC1 239..312 CDD:278826 19/72 (26%)
RCC1 317..366 CDD:278826 19/47 (40%)
RCC1 414..465 CDD:278826
Nek8XP_006532246.1 STKc_Nek8 3..258 CDD:270859
ATS1 318..663 CDD:227511 63/244 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.