DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9135 and nek9

DIOPT Version :9

Sequence 1:NP_001285655.1 Gene:CG9135 / 33850 FlyBaseID:FBgn0031769 Length:487 Species:Drosophila melanogaster
Sequence 2:XP_012823572.1 Gene:nek9 / 100216232 XenbaseID:XB-GENE-974101 Length:942 Species:Xenopus tropicalis


Alignment Length:330 Identity:82/330 - (24%)
Similarity:135/330 - (40%) Gaps:64/330 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 QAAVGRHHTLFLTDTGTVYAC-----GENKSGQCGVGNTHANIYSPTPI-NYRGPPIIRIGCGAE 231
            |...|..|...:|....:|..     |....||.|.|: .|:...|..: ..:|..:.::.||::
 Frog   355 QVCAGDAHFAVVTVEKELYTWVNMQGGSKLHGQLGHGD-RASYRQPKHVEKLQGKSVQQVSCGSD 418

  Fly   232 FSVILDIKGSLHTFGLPEYGQLGHNTDAKYFVNANKLSFHFETSPKKVVLYIEKSKEGHVTPVDG 296
            |:|.:..:|.|::||...||.||.|..|    .|..|      .|..|..::.:       ||:.
 Frog   419 FTVCISDEGQLYSFGSDYYGCLGVNQSA----GAEVL------EPLLVDFFLNE-------PVEQ 466

  Fly   297 VQIVDFACGNNHTVAIDSKKRVYSWGFGGFGRLGHAEPKDEMVPRLMKFFDTQGRGGR-----SV 356
            |     :||::|.:|:...|.|||||.|.:||||.....|...|:.::.       .|     :|
 Frog   467 V-----SCGDSHIIALTRSKCVYSWGCGEYGRLGLDSEDDVYSPQKVEV-------QRDLCIVNV 519

  Fly   357 FCGSTFSLIVNELGLLFLFGQNK--KTGEANMYPKPV------------------QDLSGWNITD 401
            .|||..|.::...|.:...|.|:  |.| .|.|...:                  :.||.:.|..
 Frog   520 CCGSDGSFLLTLTGKVLACGLNEHNKLG-LNQYTAGIINHEAFQEVPYTTSLTLAKQLSFYKIRS 583

  Fly   402 IGCANT-SIMISADDTLIAWGASPTFGELGIGEFQKSSTVPKEVPKLDNIKIPQVTMGYSHTVLL 465
            |....| :..|.....|:.:|::.. |:||:|:::|...:......|...::.:|:.|...|:..
 Frog   584 ISPGRTHTAAIDERGRLLTFGSNKC-GQLGVGDYRKHLGINLLGGPLGGKQVIRVSCGDEFTIAA 647

  Fly   466 VDTTH 470
            ....|
 Frog   648 TADNH 652

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9135NP_001285655.1 RCC1 139..184 CDD:278826 3/10 (30%)
RCC1_2 171..200 CDD:290274 6/31 (19%)
RCC1 188..236 CDD:278826 13/53 (25%)
RCC1 239..312 CDD:278826 20/72 (28%)
RCC1 317..366 CDD:278826 18/53 (34%)
RCC1 414..465 CDD:278826 11/50 (22%)
nek9XP_012823572.1 STKc_Nek9 33..290 CDD:270860
ATS1 370..708 CDD:227511 78/315 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.