DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9135 and Rcc1

DIOPT Version :9

Sequence 1:NP_001285655.1 Gene:CG9135 / 33850 FlyBaseID:FBgn0031769 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001184011.1 Gene:Rcc1 / 100088 MGIID:1913989 Length:434 Species:Mus musculus


Alignment Length:382 Identity:100/382 - (26%)
Similarity:155/382 - (40%) Gaps:112/382 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 EEKYRYVASGPSAAHTILINMDRKALGFG--RNPSGQLGLSQDIKLAEKPTIIPALEQLN--IVQ 173
            :||...|::|.|  ||..:..|.:...:|  |:.:|.:||.:.:    |.:::|...||:  :|:
Mouse   131 QEKVVQVSAGDS--HTAALTEDGRVFLWGSFRDNNGVIGLLEPM----KKSMVPVQVQLDAPVVK 189

  Fly   174 AAVGRHHTLFLTDTGTVY--ACGE------------NKSGQCGVGNTHANIYSPTPI-----NYR 219
            .|.|..|.:.||:.|.:|  .|||            |:.|:.|:|    .:..|..:     ..|
Mouse   190 VASGNDHLVMLTNDGDLYTLGCGEQGQLGRVPELFANRGGRQGLG----RLLVPRCVLLKSRGTR 250

  Fly   220 GPPIIRIG---CGAEFSVILDIKGSLHTFGLPEYGQLGHNTDAKYFVNANKLSFHFETSPKKVVL 281
            |.  :|..   |||.|:..:..:|.::.|||..|.|||.......|:..|..||...|       
Mouse   251 GR--VRFQDAFCGAYFTFAISREGHVYGFGLSNYHQLGTPGTGSCFIPQNLTSFKNST------- 306

  Fly   282 YIEKSKEGHVTPVDGVQIVDFACGNNHTVAIDSKKRVYSWGFGGFGRLGHAEPKDE-MVPRLMKF 345
               ||..|            |:.|.:|||.:||:.:.||.|...:||||..|..:| .:|.|:..
Mouse   307 ---KSWVG------------FSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISR 356

  Fly   346 FDTQGRGGRSVFCGSTFSLIVNELGLLFLFGQNKKTGEANMYPKPVQDLSGWNITDIGCANTSIM 410
            .....    ||.||::                                        :|.|     
Mouse   357 LPVVS----SVACGAS----------------------------------------VGYA----- 372

  Fly   411 ISADDTLIAWGASPTFGELGIGEFQKS-STVPKEVPKLDNIKIPQVTMGYSHTVLLV 466
            :|.|..:.|||....: :||.|:.:.: |.|.....:|:|..:..|:.|..||||||
Mouse   373 VSKDGRVFAWGMGTNY-QLGTGQDEDAWSPVEMTGKQLENRVVLTVSSGGQHTVLLV 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9135NP_001285655.1 RCC1 139..184 CDD:278826 13/48 (27%)
RCC1_2 171..200 CDD:290274 12/42 (29%)
RCC1 188..236 CDD:278826 17/69 (25%)
RCC1 239..312 CDD:278826 21/72 (29%)
RCC1 317..366 CDD:278826 15/49 (31%)
RCC1 414..465 CDD:278826 16/51 (31%)
Rcc1NP_001184011.1 RCC1 48..95 CDD:278826
RCC1 98..147 CDD:278826 7/17 (41%)
RCC1 150..200 CDD:278826 14/53 (26%)
RCC1_2 187..216 CDD:290274 11/28 (39%)
RCC1 203..268 CDD:278826 17/70 (24%)
RCC1 271..322 CDD:278826 21/72 (29%)
RCC1 325..368 CDD:278826 15/46 (33%)
RCC1 376..427 CDD:278826 16/51 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.