DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IPIP and Pheta2

DIOPT Version :9

Sequence 1:NP_001137795.2 Gene:IPIP / 33849 FlyBaseID:FBgn0031768 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001123983.1 Gene:Pheta2 / 688685 RGDID:1586415 Length:259 Species:Rattus norvegicus


Alignment Length:196 Identity:75/196 - (38%)
Similarity:106/196 - (54%) Gaps:30/196 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKINEKNLYVFART-PPFDMEGFLNKRG-----EVNKAFQRRY-FVLKGNLLFYFESRLDKEPLG 58
            ||:|::::..:|.: .|.|..|||...|     .......||| |||||||||.||||..:.||.
  Rat     1 MKLNKRSVAHYALSDSPADHTGFLRSWGGPGSPPTPSGTGRRYWFVLKGNLLFSFESRESRVPLS 65

  Fly    59 LIIVEGCTIELSNE--VDNYCFEIAFN--GNRTYILAAENQDSMETWMKALTCAGYEYKRIILAE 119
            |:::||||:||:..  .:.:.|.|.|:  |.|.::|||:.|.:.|.|:|||:.|.:.|.|:::.|
  Rat    66 LVVLEGCTVELAEAPVPEEFAFAIRFDAPGVRPHLLAADGQAAQEAWVKALSRASFGYMRLVVRE 130

  Fly   120 LKRQLQEMEDARNKMLGSALD--GPQNASES-AKPRPPPRRTNPFNRPAPP-----PPDSSLRGG 176
            |:.|||   |||..:   ||.  .||.|..| :|.:.|..|.     |.|.     |.|.:..|.
  Rat   131 LESQLQ---DARQSL---ALHRCAPQRAVASRSKSQAPDHRA-----PGPENGHFLPRDGNSMGT 184

  Fly   177 V 177
            |
  Rat   185 V 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IPIPNP_001137795.2 PH_Ses 11..127 CDD:270105 54/126 (43%)
PH 19..105 CDD:278594 41/95 (43%)
Pheta2NP_001123983.1 PH-like 11..138 CDD:302622 54/129 (42%)
PH 20..120 CDD:278594 43/99 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7287
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 125 1.000 Inparanoid score I4610
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003195
OrthoInspector 1 1.000 - - otm45324
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22902
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3662
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.060

Return to query results.
Submit another query.