DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IPIP and pheta1

DIOPT Version :9

Sequence 1:NP_001137795.2 Gene:IPIP / 33849 FlyBaseID:FBgn0031768 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_005162521.2 Gene:pheta1 / 565272 ZFINID:ZDB-GENE-041210-163 Length:256 Species:Danio rerio


Alignment Length:257 Identity:86/257 - (33%)
Similarity:132/257 - (51%) Gaps:54/257 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKINEKNL--YVFARTPPFDMEGFLNKRGEVNKAFQRRYFVLKGNLLFYFESRLDKEPLGLIIVE 63
            ||:||:::  |....:|| |..|||.|:||.|.|:.||:.:||||:|||||.|..:||:|:|::|
Zfish     1 MKLNERSVAHYATCNSPP-DKTGFLFKKGERNTAYHRRWCILKGNMLFYFEERESREPIGVIVLE 64

  Fly    64 GCTIEL-SNEVDNYCFEIAFN--GNRTYILAAENQDSMETWMKALTCAGYEYKRIILAELKRQLQ 125
            |||:|| .:|.:.:.|.|.|.  ..|.|.:|||||.:||:|:|||:.|.::|.|:::.||:|||:
Zfish    65 GCTVELCESESEEFAFAIKFECAKARVYKMAAENQAAMESWVKALSRASFDYMRLVVKELERQLE 129

  Fly   126 EM-EDARN------------------------KMLGSALDGPQNASESAKPRPPPRRTNPFN--- 162
            |: |:||:                        .:.|...:|..|.........|....|..:   
Zfish   130 EVQEEARSSQAKSKTKKNQTGLRISSASVQSASITGPCQEGLSNRENGVSWSKPSSVANGLSEGC 194

  Fly   163 -------------RPAPPPPDSSLRGGVVMSPL-------PFINGYFGSSNARLQQEKLMSK 204
                         :|.|.||.....||.:.||:       ..::.::|...|.|:.|.|.|:
Zfish   195 AWDRDCNVRADGVKPPPIPPRRKTNGGSLESPVSPGTGCFSKLHDWYGKEVAELRVEWLQSQ 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IPIPNP_001137795.2 PH_Ses 11..127 CDD:270105 58/118 (49%)
PH 19..105 CDD:278594 45/88 (51%)
pheta1XP_005162521.2 PH_Ses 11..131 CDD:270105 59/120 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I7138
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4542
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003195
OrthoInspector 1 1.000 - - otm24813
orthoMCL 1 0.900 - - OOG6_106541
Panther 1 1.100 - - LDO PTHR22902
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4038
SonicParanoid 1 1.000 - - X3662
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.990

Return to query results.
Submit another query.