DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IPIP and def6c

DIOPT Version :9

Sequence 1:NP_001137795.2 Gene:IPIP / 33849 FlyBaseID:FBgn0031768 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_692142.2 Gene:def6c / 563690 ZFINID:ZDB-GENE-060503-87 Length:620 Species:Danio rerio


Alignment Length:276 Identity:53/276 - (19%)
Similarity:94/276 - (34%) Gaps:89/276 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EGFLNKRGEVNKAFQRRYFVLKGNLLFYFESRLDKEPLGLIIVEGCTI--ELSNEVDNYCFEIAF 82
            :|:|.|:|.|.:.:|.|:||||...|.|:.:...||..|.|::|..::  .:.::....|.....
Zfish   216 KGYLVKKGHVRRNWQERWFVLKPGSLIYYVAEDQKEKKGEILLEESSVVESVPDKEGRRCLFCVK 280

  Fly    83 NGNRTYILAAENQDSMETWMKALTCAGYEYKRIILAELKRQL-QEMEDARNKMLGSALDGPQNAS 146
            ...|||.::|.|......||:|:..|   ::  :.||.|..| |:::.:|.|             
Zfish   281 TSVRTYEMSASNLKQRVDWMQAIQMA---FR--LRAEGKSSLHQDLKLSRRK------------- 327

  Fly   147 ESAKPRPPPRRTNPFNRPAPPPPDSSLRGGVVMSPLPFINGYFGSSNARLQQEKLMSKQDANGNG 211
                                                              |:|.|...|......
Zfish   328 --------------------------------------------------QRETLQRSQSNQSTH 342

  Fly   212 SPSGTPRAQRRPTPAPAIANSVFYPDVRDPGAANNNHSTVNGAERQRRQV--KALEEFARNHER- 273
            :.|....|.:...|             ...|...:....:....:::|:|  |..||..:.||: 
Zfish   343 NESSAVEASQHSAP-------------EQQGETESLEQHIESIIQKQREVEAKCKEEEKQEHEKQ 394

  Fly   274 --FRRELMPDVSAYRE 287
              .:|:|...:...:|
Zfish   395 QAIQRDLEKQLEEAKE 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IPIPNP_001137795.2 PH_Ses 11..127 CDD:270105 33/109 (30%)
PH 19..105 CDD:278594 26/86 (30%)
def6cXP_692142.2 PH_SWAP-70 206..315 CDD:270092 30/103 (29%)
PH 213..306 CDD:278594 27/89 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.