DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IPIP and pheta2

DIOPT Version :9

Sequence 1:NP_001137795.2 Gene:IPIP / 33849 FlyBaseID:FBgn0031768 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001038864.1 Gene:pheta2 / 556313 ZFINID:ZDB-GENE-060825-273 Length:282 Species:Danio rerio


Alignment Length:313 Identity:90/313 - (28%)
Similarity:132/313 - (42%) Gaps:92/313 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKINEKNL-YVFARTPPFDMEGFLNKRGEVNKAFQRRYFVLKGNLLFYFESRLDKEPLGLIIVEG 64
            |||::|.| :..:.|.|.|.||:|.|:.|.|..:.||:||||||||||.|...|:..||:|::||
Zfish     1 MKIHKKILTHYLSCTSPVDKEGYLYKKRERNTTYLRRWFVLKGNLLFYQERPGDRNLLGVIVLEG 65

  Fly    65 CTIELSNEVDNYCFEIAFNGN--RTYILAAENQDSMETWMKALTCAGYEYKRIILAELKR----- 122
            |.::.......:||.:.|.|.  |||.|||::..|.|:|:.||.||.:.|..:|:.:|:|     
Zfish    66 CMVQACETDGQFCFSLVFTGPGLRTYRLAADDHPSQESWIAALFCASHIYLSMIVRDLERRYEEA 130

  Fly   123 ----------QLQEMEDARNKMLGS---------------ALDGPQNASESAKPRPPPRRTNPFN 162
                      |..|:..|.|.::.|               ..||...::.|..|...|.|.:.|:
Zfish   131 KRDKGLCVSIQTSEVTSAPNTIMASWYTGQPYFIQGTSIVPRDGRSYSTSSIAPTYVPNRPSNFS 195

  Fly   163 RPAPPPPDSSLRGGVVMSPLPFINGYFGSSNARLQQEKLMSKQDANGNGSPSGTPRAQRRPTP-- 225
            ..|||                   ..|.::|.|                ||...|:.....||  
Zfish   196 LHAPP-------------------AQFKATNKR----------------SPKLWPKRNAHVTPLN 225

  Fly   226 APAIANSVFYPDVRDPGAANNNHSTVNGAERQRRQVKALEEFARNHERFRREL 278
            .||.::|.:.....||                      ||||::.||.:..|:
Zfish   226 GPAPSHSEWPMMGFDP----------------------LEEFSKLHEHYGNEV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IPIPNP_001137795.2 PH_Ses 11..127 CDD:270105 51/132 (39%)
PH 19..105 CDD:278594 39/87 (45%)
pheta2NP_001038864.1 PH_Ses 11..130 CDD:270105 50/118 (42%)
PH 18..108 CDD:278594 40/89 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4542
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003195
OrthoInspector 1 1.000 - - otm24813
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22902
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.