DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IPIP and PLEKHJ1

DIOPT Version :9

Sequence 1:NP_001137795.2 Gene:IPIP / 33849 FlyBaseID:FBgn0031768 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001287765.1 Gene:PLEKHJ1 / 55111 HGNCID:18211 Length:277 Species:Homo sapiens


Alignment Length:277 Identity:61/277 - (22%)
Similarity:101/277 - (36%) Gaps:65/277 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKINEKNLYVFARTPPFDMEGFLNKRG-EVNKAFQRRYFVLKGNLLFYFESRLDK-EPLGLIIVE 63
            |:.|||.|...:|.|. :|...|..|| :.....:||...|..|.||||  |.|: ||:|.:::|
Human     1 MRYNEKELQALSRQPA-EMAAELGMRGPKKGSVLKRRLVKLVVNFLFYF--RTDEAEPVGALLLE 62

  Fly    64 GCTIELSNEVDNYCFEIAFNGNRTYILAAENQDSMETWMKALTCAGYEYKRIILAELKRQLQEME 128
            .|.: :..|...:......:..|.|.....:::..:.||:||..|.||:.|..|...:.:::::.
Human    63 RCRV-VREEPGTFSISFIEDPERKYHFECSSEEQCQEWMEALRRASYEFMRRSLIFYRNEIRKVT 126

  Fly   129 DARNKMLGSALDGP------------------------------------------QNASESAKP 151
            ..:::   ...|.|                                          ..|...|:.
Human   127 GKKHQ---GTHDRPAPHRRACCEPWTAEKYKSKCTCSTCPRRPHSTIAQHMASCVTAQAPSHARA 188

  Fly   152 RPPPRRTNPFNRPAPPPPDSSLRGGVVMSPLPFINGYFGSSNARLQQEKLMSKQDANGNGSPSGT 216
            :|.|||.|.....:         .||.:.......|..|..:.|.:     :.::..|:|...||
Human   189 QPTPRRVNSLGVHS---------AGVKVKSSGQAPGRSGRGSGRGE-----ASEECGGDGPAFGT 239

  Fly   217 PRAQRRPTPAPAIANSV 233
            ..|:|...|.....|.|
Human   240 GAARRGSRPGGVSENGV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IPIPNP_001137795.2 PH_Ses 11..127 CDD:270105 33/117 (28%)
PH 19..105 CDD:278594 24/87 (28%)
PLEKHJ1NP_001287765.1 PH_PLEKHJ1 1..112 CDD:270078 36/114 (32%)
PH 25..108 CDD:278594 25/85 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22902
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.