DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IPIP and Y37D8A.25

DIOPT Version :9

Sequence 1:NP_001137795.2 Gene:IPIP / 33849 FlyBaseID:FBgn0031768 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001022833.1 Gene:Y37D8A.25 / 3565405 WormBaseID:WBGene00012560 Length:141 Species:Caenorhabditis elegans


Alignment Length:139 Identity:40/139 - (28%)
Similarity:68/139 - (48%) Gaps:15/139 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKINEKNLYVFARTPPFD--MEGFLNKRGEVNKAFQRR--YFVLKGNLLFYF---ESRLDKEPLG 58
            |..|..:|:.....|.|:  ..|.|    ::.:.||.|  :.|||.|:||.:   |......|..
 Worm     1 MLANANSLFRLGSDPTFERRFSGPL----QLQQDFQWRAGWGVLKANMLFVYNKTEEETSAPPFL 61

  Fly    59 LIIVEGCTIELSNE---VDNYCFEIAFNGN-RTYILAAENQDSMETWMKALTCAGYEYKRIILAE 119
            |:|:|.|.|||.:|   ..::.|||.|... |::|.||::..|:..|:..||.:..:|.::....
 Worm    62 LLIIEDCFIELCDENKIGKDFTFEIKFKSTARSFIFAADSFKSLGRWVSLLTISPIDYIQLSKQS 126

  Fly   120 LKRQLQEME 128
            ...|:::.:
 Worm   127 FHEQIEQTQ 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IPIPNP_001137795.2 PH_Ses 11..127 CDD:270105 37/126 (29%)
PH 19..105 CDD:278594 31/94 (33%)
Y37D8A.25NP_001022833.1 PH-like 31..133 CDD:388408 33/101 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I8444
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003195
OrthoInspector 1 1.000 - - oto18137
orthoMCL 1 0.900 - - OOG6_106541
Panther 1 1.100 - - LDO PTHR22902
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4038
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.