DRSC - DRSC Integrative Ortholog Prediction Tool

Protein Alignment IPIP and Pheta2

Sequence 1:	NP_608984.2	Gene:	IPIP / 33849	FlyBaseID:	FBgn0031768	Length:	296	Species:	Drosophila melanogaster
Sequence 2:	NP_796365.1	Gene:	Pheta2 / 338368	MGIID:	2443609	Length:	259	Species:	Mus musculus

Alignment Length:	30	Identity:	9/30 - (30%)
Similarity:	12/30 - (40%)	Gaps:	9/30 - (30%)

- Green bases have known domain annotations that are detailed below.

  Fly    34 CACPRIYDPVCGTDLSTYANRCMLD-CKAE 62
            ||...::....||        |.|| |:.|
Mouse   287 CAFHPVFSLTSGT--------CRLDYCRPE 308

Gene	Sequence	Domain	Region	External ID	Identity
IPIP	NP_608984.2	PH_Ses	11..127	CDD:270105	9/30 (30%)
Pheta2	NP_796365.1	PH-like	11..138	CDD:473070
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	155..178
		F&H	223..235
Blue background indicates that the domain is not in the aligned region.