DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IPIP and Pheta1

DIOPT Version :9

Sequence 1:NP_001137795.2 Gene:IPIP / 33849 FlyBaseID:FBgn0031768 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001363745.1 Gene:Pheta1 / 288664 RGDID:1310656 Length:234 Species:Rattus norvegicus


Alignment Length:285 Identity:89/285 - (31%)
Similarity:127/285 - (44%) Gaps:89/285 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKINEKNLYVFAR-TPPFDMEGFLNKRGEVNKAFQRRYFVLKGNLLFYFESRLDKEPLGLIIVEG 64
            ||:||::|..:|. ..|.|..|||.|||.......||:|||:||:||||||...:||||:|::||
  Rat     1 MKLNERSLAFYATCDAPVDNAGFLYKRGGRGAGSHRRWFVLRGNILFYFESESSREPLGVILLEG 65

  Fly    65 CTIELSNEVDNYCFEIAFNGNRT--YILAAENQDSMETWMKALTCAGYEYKRIILAELKRQLQEM 127
            ||:||.:..:.:.|.:.|.|.|:  |:|||::|.::|.|:|||:.|.:.|.|:::.||::||..|
  Rat    66 CTVELVDAREEFAFAVRFAGGRSRPYVLAADSQAALEGWVKALSRASFHYLRLVVRELEQQLAAM 130

  Fly   128 EDARNKMLGSALDGPQNASESAKP----RPPPRRTNPFNRPAPPPPDSSLRGGVVMSPLPFINGY 188
            .:      ||    |.||...|.|    .|.|:.                .|..|.|.||     
  Rat   131 RE------GS----PANALPDANPSTVLNPKPKE----------------NGRAVWSALP----- 164

  Fly   189 FGSSNARLQQEKLMSKQDANGNGSPSGTPRAQRRPTPAPAIANSVFYPDVRDPGAANNNHSTVNG 253
                                  ..|:..||  |.|.|....|::...|.|               
  Rat   165 ----------------------EQPAVAPR--RPPLPPRRRASAANGPSV--------------- 190

  Fly   254 AERQRRQVKALEEFARNHERFRREL 278
                        .||:.|||:..|:
  Rat   191 ------------SFAQLHERYGLEV 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IPIPNP_001137795.2 PH_Ses 11..127 CDD:270105 54/118 (46%)
PH 19..105 CDD:278594 42/87 (48%)
Pheta1NP_001363745.1 PH_Ses 11..130 CDD:270105 54/118 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..189 20/103 (19%)
F&H 191..203 5/11 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7287
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 125 1.000 Inparanoid score I4610
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003195
OrthoInspector 1 1.000 - - otm45324
orthoMCL 1 0.900 - - OOG6_106541
Panther 1 1.100 - - LDO PTHR22902
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3662
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.960

Return to query results.
Submit another query.