DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IPIP and CG42271

DIOPT Version :10

Sequence 1:NP_608984.2 Gene:IPIP / 33849 FlyBaseID:FBgn0031768 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_996434.2 Gene:CG42271 / 2768892 FlyBaseID:FBgn0259166 Length:1280 Species:Drosophila melanogaster


Alignment Length:191 Identity:50/191 - (26%)
Similarity:77/191 - (40%) Gaps:44/191 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKINEKNLYVFARTPP--FD----------MEGFLNKRGEVNKAFQRRYFVLKGNLLFYFESRLD 53
            |:.|:..|...|..|.  ||          .||||.:..||.   ..|:..|:||||||.:   |
  Fly     1 MRFNKPELNSLASNPATRFDKEGLLIITDRQEGFLWRSSEVR---VERWCKLRGNLLFYLK---D 59

  Fly    54 KEP----LGLIIVEGCTIELSNE---VDNYCFEIAFNGNRTYILAAENQDSMETWMKALTCAGYE 111
            |:|    .||:::|.|...:.||   .:.|.|::.|..:.:......:......|::.:..|..|
  Fly    60 KDPKSAVAGLLVLENCRARIQNEERDSEGYVFDLDFKDSPSERFITRSSAERLAWVQCIEHASSE 124

  Fly   112 YKRIILAELKRQL-----QEMEDARNKM-----LGSALDGP---------QNASESAKPRP 153
            ....::.:||.|:     |....|.:.|     ||..|:..         |.|.|.:.|.|
  Fly   125 KLNALIRQLKEQIVSQSRQPSSGASSSMGNHIDLGMPLEQQMQEQLQLHGQPAEELSVPVP 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IPIPNP_608984.2 PH_Ses 11..127 CDD:270105 37/139 (27%)
CG42271NP_996434.2 PH_INPP4A_INPP4B 1..145 CDD:270091 40/149 (27%)
C2 201..318 CDD:472691
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.