DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IPIP and Pheta1

DIOPT Version :9

Sequence 1:NP_001137795.2 Gene:IPIP / 33849 FlyBaseID:FBgn0031768 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001346878.1 Gene:Pheta1 / 231717 MGIID:2442708 Length:266 Species:Mus musculus


Alignment Length:300 Identity:97/300 - (32%)
Similarity:134/300 - (44%) Gaps:95/300 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKINEKNLYVFAR-TPPFDMEGFLNKRGEVNKAFQRRYFVLKGNLLFYFESRLDKEPLGLIIVEG 64
            ||:||::|..:|. ..|.|..|||.|||.......||:|||:||:|||||:...:||||:|::||
Mouse     1 MKLNERSLAFYATCDAPVDNAGFLYKRGGRGTGSHRRWFVLRGNILFYFEAEGSREPLGVILLEG 65

  Fly    65 CTIELSNEVDNYCFEIAFNGNRT--YILAAENQDSMETWMKALTCAGYEYKRIILAELKRQLQEM 127
            ||:||.:..:.:.|.:.|.|.|:  |:|||::|.::|.|:|||:.|.:.|.|:::.||::||..|
Mouse    66 CTVELVDAREEFAFAVRFAGGRSRPYVLAADSQAALEGWVKALSRASFHYLRLVVRELEQQLAAM 130

  Fly   128 EDARNKMLGSALDGPQNASESAKPRPPPRRTNPFNRPAPPPPDSSLR----GGVVMSPLPFINGY 188
            .:      ||    |.||                 .||.|.|..:.|    |.||.|.||     
Mouse   131 RE------GS----PANA-----------------LPANPSPVLTQRPKENGWVVWSTLP----- 163

  Fly   189 FGSSNARLQQEKLMSKQDANGNGSPSGTPRAQRRPTPAPAIANSVFYPDVRDPGAANNNHSTVNG 253
                                  ..||..|   :||.|.|                .....|..||
Mouse   164 ----------------------EQPSVAP---QRPPPLP----------------PRRRASAANG 187

  Fly   254 AERQRRQVKALEEFARNHERFRRELMPDVSAYRE--RQGQ 291
                     .|..||:.|.|:..|    |.|.|:  |.||
Mouse   188 ---------PLASFAQLHARYGLE----VQALRDQWRGGQ 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IPIPNP_001137795.2 PH_Ses 11..127 CDD:270105 53/118 (45%)
PH 19..105 CDD:278594 41/87 (47%)
Pheta1NP_001346878.1 PH_Ses 11..130 CDD:270105 53/118 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 164..184 7/38 (18%)
F&H 191..203 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7593
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4714
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003195
OrthoInspector 1 1.000 - - otm43250
orthoMCL 1 0.900 - - OOG6_106541
Panther 1 1.100 - - LDO PTHR22902
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4038
SonicParanoid 1 1.000 - - X3662
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.990

Return to query results.
Submit another query.