DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IPIP and PHETA2

DIOPT Version :9

Sequence 1:NP_001137795.2 Gene:IPIP / 33849 FlyBaseID:FBgn0031768 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001002034.2 Gene:PHETA2 / 150368 HGNCID:27161 Length:259 Species:Homo sapiens


Alignment Length:168 Identity:62/168 - (36%)
Similarity:95/168 - (56%) Gaps:14/168 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKINEKNLYVFART-PPFDMEGFLNKRG------EVNKAFQRRYFVLKGNLLFYFESRLDKEPLG 58
            ||:||:::..:|.: .|.|..|||...|      ..:...:|.:|||||||||.||||..:.||.
Human     1 MKLNERSVAHYALSDSPADHMGFLRTWGGPGTPPTPSGTGRRCWFVLKGNLLFSFESREGRAPLS 65

  Fly    59 LIIVEGCTIELSNE--VDNYCFEIAFN--GNRTYILAAENQDSMETWMKALTCAGYEYKRIILAE 119
            |:::||||:||:..  .:.:.|.|.|:  |.|.::||||...:.|.|:|.|:.|.:.|.|:::.|
Human    66 LVVLEGCTVELAEAPVPEEFAFAICFDAPGVRPHLLAAEGPAAQEAWVKVLSRASFGYMRLVVRE 130

  Fly   120 LKRQLQEMEDARNKMLGSALDGPQNASESAKPRPPPRR 157
            |:.|||   |||..:........::.:...||:.|..|
Human   131 LESQLQ---DARQSLALQRRSSWKSVASRCKPQAPNHR 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IPIPNP_001137795.2 PH_Ses 11..127 CDD:270105 51/126 (40%)
PH 19..105 CDD:278594 39/95 (41%)
PHETA2NP_001002034.2 PH-like 11..138 CDD:327399 51/129 (40%)
F&H 223..235
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003195
OrthoInspector 1 1.000 - - otm41184
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22902
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3662
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.