DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IPIP and LOC101732662

DIOPT Version :9

Sequence 1:NP_001137795.2 Gene:IPIP / 33849 FlyBaseID:FBgn0031768 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_004918165.1 Gene:LOC101732662 / 101732662 -ID:- Length:168 Species:Xenopus tropicalis


Alignment Length:143 Identity:51/143 - (35%)
Similarity:86/143 - (60%) Gaps:13/143 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKINEKNLYVFARTPPFDMEGFLNKRGEVNKA-FQRRYFVLKGNLLFYFESRLDKEPLGLIIVEG 64
            ||:...::  .|.:.| :.:|:|.|:|..|.: :|||:|:|.||||||:|.:.|.:|||:|::|.
 Frog     1 MKLKVSSM--LAGSAP-ERQGYLLKKGSRNHSPYQRRWFLLWGNLLFYYEKQGDPQPLGVIVLER 62

  Fly    65 CTIELSNEVDNYCFEIAFNGNRTYILAAENQDSMETWMKALTCAGYEYKRIILAELKRQLQEMED 129
            |::.|......:.|.: ::.:|.|.:|||:|..:|.|:|||..|...|.:.:|.|::.|.|    
 Frog    63 CSVSLRPSRLEFAFSL-YSLSRVYKMAAESQKDLELWVKALFSANVGYTKALLDEVQGQYQ---- 122

  Fly   130 ARNKMLGSALDGP 142
                :|.:..|||
 Frog   123 ----ILNAGDDGP 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IPIPNP_001137795.2 PH_Ses 11..127 CDD:270105 45/116 (39%)
PH 19..105 CDD:278594 35/86 (41%)
LOC101732662XP_004918165.1 PH-like 12..122 CDD:388408 43/111 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003195
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.