DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IPIP and pheta2

DIOPT Version :9

Sequence 1:NP_001137795.2 Gene:IPIP / 33849 FlyBaseID:FBgn0031768 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_004913853.1 Gene:pheta2 / 100488560 XenbaseID:XB-GENE-985681 Length:256 Species:Xenopus tropicalis


Alignment Length:216 Identity:83/216 - (38%)
Similarity:119/216 - (55%) Gaps:30/216 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKINEKNLYVFART-PPFDMEGFLNKRGEVNKAFQRRYFVLKGNLLFYFESRLDKEPLGLIIVEG 64
            ||:||:::..:|.: .|.|..|:|.|||..:.|:|:|:||||||||||||.:.:|||:|::::||
 Frog     1 MKLNERSMAHYATSGSPADCTGYLYKRGVKHTAYQKRWFVLKGNLLFYFEEQGNKEPVGVVVLEG 65

  Fly    65 CTIEL--SNEVDNYCFEIAFNGNRTYILAAENQDSMETWMKALTCAGYEYKRIILAELKRQLQEM 127
            |.|||  |||...:|......|:|:||||||.|:.||.|:|||:.|.::|.|:::.||:|||:.|
 Frog    66 CAIELCHSNEEHAFCVRFDGPGSRSYILAAETQEEMECWVKALSRASFDYMRLVVRELERQLELM 130

  Fly   128 EDARNKMLGSALDGPQNASESAK---PRPP--------PRRTN----------PFNRPAPPPPDS 171
            :....:.......|...|....|   .|||        |..||          ....|.|||...
 Frog   131 QKTSIRRKPGRHRGRSRAVSRTKWENSRPPELCNGFLHPEDTNLETHTRVSGSSIPPPLPPPLPP 195

  Fly   172 SLRGGVVMSPLPFINGYFGSS 192
            ..||..      ::||...:|
 Frog   196 RRRGAA------WVNGASSAS 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IPIPNP_001137795.2 PH_Ses 11..127 CDD:270105 60/118 (51%)
PH 19..105 CDD:278594 47/87 (54%)
pheta2XP_004913853.1 PH_Ses 11..130 CDD:270105 60/118 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6762
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4438
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003195
OrthoInspector 1 1.000 - - otm48394
Panther 1 1.100 - - LDO PTHR22902
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4038
SonicParanoid 1 1.000 - - X3662
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.180

Return to query results.
Submit another query.