powered by:
Protein Alignment CG9117 and C25D7.16
DIOPT Version :9
Sequence 1: | NP_608983.2 |
Gene: | CG9117 / 33846 |
FlyBaseID: | FBgn0031766 |
Length: | 228 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001122858.1 |
Gene: | C25D7.16 / 6418697 |
WormBaseID: | WBGene00050940 |
Length: | 118 |
Species: | Caenorhabditis elegans |
Alignment Length: | 42 |
Identity: | 14/42 - (33%) |
Similarity: | 17/42 - (40%) |
Gaps: | 9/42 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 129 NAEVVVR------RSPGHTLSCVSVLVENSQLGG--RVGITG 162
|.|:.|| ..| .|..|.:|......|.| |:|.||
Worm 49 NEEIHVRIELKPMEFP-DTNRCKAVQANTIPLVGDHRLGCTG 89
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4736 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.