DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9117 and mblac1

DIOPT Version :9

Sequence 1:NP_608983.2 Gene:CG9117 / 33846 FlyBaseID:FBgn0031766 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_692640.5 Gene:mblac1 / 564200 ZFINID:ZDB-GENE-111102-2 Length:234 Species:Danio rerio


Alignment Length:207 Identity:84/207 - (40%)
Similarity:117/207 - (56%) Gaps:18/207 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QRNQVTVLQVGYSRQEEGDESAMRANCTCTLVRCRDGTNII-VDTLTAWDGDHLRSLLGQQGLGV 71
            |...|:||:.||...|  |:.|.||:.|.||:   .|.||| |||...||.|.|.:.|.::||..
Zfish    41 QPYSVSVLKEGYCTAE--DDGAFRADGTITLI---TGPNIILVDTGGPWDRDFLVAKLKEKGLTP 100

  Fly    72 DDIHVVVCSHGHSDHIGCNYLFQKARMHLVGACASHHDLYM-DHLGSGNPDEQLALDSNAEVVVR 135
            |.:.:||.:||||||:|...||.:|:: :||:..|..|.|: :.|..|.|   ..:|....::. 
Zfish   101 DSVDIVVGTHGHSDHVGNLGLFPEAKI-IVGSDISVRDKYLPNQLAEGQP---YTIDDFVSIIF- 160

  Fly   136 RSPGHTLSCVSVLVENSQLGGRVGITGDLFERREDIDDENIWMDAGSENEKVQREERSKMAQLCE 200
             :|||....|||||:.:. .|.|.:.||||||   ..||:.|.:. |||.::|...|....|:.:
Zfish   161 -TPGHMGRDVSVLVKGTS-EGSVLVAGDLFER---CHDEDSWKEL-SENPQIQEANRQMALQMAD 219

  Fly   201 FIIPGHGPMFSV 212
            .|||||||:|.|
Zfish   220 VIIPGHGPLFRV 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9117NP_608983.2 GloB 1..208 CDD:223565 80/201 (40%)
MBLAC1-like_MBL-fold 11..210 CDD:293797 81/200 (41%)
mblac1XP_692640.5 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576401
Domainoid 1 1.000 95 1.000 Domainoid score I7379
eggNOG 1 0.900 - - E1_KOG4736
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H45596
Inparanoid 1 1.050 117 1.000 Inparanoid score I4785
OMA 1 1.010 - - QHG49427
OrthoDB 1 1.010 - - D1139836at2759
OrthoFinder 1 1.000 - - FOG0005797
OrthoInspector 1 1.000 - - oto41356
orthoMCL 1 0.900 - - OOG6_106885
Panther 1 1.100 - - LDO PTHR23200
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2955
SonicParanoid 1 1.000 - - X4775
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.