DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9117 and B0432.9

DIOPT Version :9

Sequence 1:NP_608983.2 Gene:CG9117 / 33846 FlyBaseID:FBgn0031766 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001379578.1 Gene:B0432.9 / 259415 WormBaseID:WBGene00015190 Length:212 Species:Caenorhabditis elegans


Alignment Length:203 Identity:51/203 - (25%)
Similarity:72/203 - (35%) Gaps:67/203 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GT-NIIVDTLTA--------WDGDHLRSLLGQQGLGVDDIHVVVCSHGHSDHIGCNYLFQKARMH 99
            || .:|:||.|.        |:|..:...|.:..:....:..||.:|||.||.....|||:|.:.
 Worm    21 GTVGLIIDTTTVTLIDAGDPWNGLEIVQKLQELHVAPSTVTHVVVTHGHLDHCANLGLFQEASVI 85

  Fly   100 L---VGACASHHDLYMDHLGSGNPDEQLALDSNAEVVVRRSPGHTLSCVSVLVENSQLGGRVG-- 159
            :   ||........|     |..|.....:..|.|  ::...|||.|....:|     .|::|  
 Worm    86 MDWDVGRKCGGKAKY-----SVIPGWPYRISDNLE--LQNLSGHTASDTIAIV-----SGKIGNS 138

  Fly   160 -----ITGDLFERRED-----------------IDDENIWMDAGSENEKVQREERSKMAQLCEFI 202
                 .:|||.|..:|                 |..|.|: .||                  :.|
 Worm   139 KKIVVYSGDLIEDFQDLKNFDPLELLENPSDLLISHEYIF-GAG------------------DVI 184

  Fly   203 IPGHGPMF 210
            |||||..|
 Worm   185 IPGHGATF 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9117NP_608983.2 GloB 1..208 CDD:223565 49/199 (25%)
MBLAC1-like_MBL-fold 11..210 CDD:293797 50/201 (25%)
B0432.9NP_001379578.1 metallo-hydrolase-like_MBL-fold 3..192 CDD:419960 50/201 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49427
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005797
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106885
Panther 1 1.100 - - O PTHR23200
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4775
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.