DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9117 and C25D7.5

DIOPT Version :9

Sequence 1:NP_608983.2 Gene:CG9117 / 33846 FlyBaseID:FBgn0031766 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_506705.2 Gene:C25D7.5 / 182884 WormBaseID:WBGene00007717 Length:362 Species:Caenorhabditis elegans


Alignment Length:221 Identity:52/221 - (23%)
Similarity:91/221 - (41%) Gaps:24/221 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PAQRNQVTVLQVGYSRQEEGDES-AMRANCTCTLVRCRDGTNI-IVDTLTAWDGDHLRSLLGQQG 68
            |.:::.|.:..:.......|:.| :::.:....||  |||..: :|||........:...|...|
 Worm   152 PVKKSNVVLQMLTIPSLSRGNYSNSLKLHTNSVLV--RDGACVFVVDTGLPSQKKQISKNLASYG 214

  Fly    69 LGVDDIHVVVCSHGHSDHIGCNYLFQKARMHLVGACASHHDLYMDHLGSGNPDEQ---LALDSNA 130
            .....|..||.:.......|...||..::..:..|     .:|.|::......|:   |.|.| .
 Worm   215 APAKKIKFVVVTSSQPQFSGNLNLFPFSQFIMADA-----TMYKDNIVFMKRFEKHSILELCS-P 273

  Fly   131 EVVVRRSPGHTLSCVSVLVENSQLGGRVGITGDLFERREDID--DENIWMDAGSENEKVQREERS 193
            ..:::.:||.|.:.::|::.|..|.|.:.|.|.||....|::  |.|...|       :.:...|
 Worm   274 NSLIQSTPGPTPNSITVIIRNVDLMGTIAIAGALFPNGNDLNVFDRNSVYD-------IDKLIES 331

  Fly   194 KMAQLCE--FIIPGHGPMFSVTQSMR 217
            :...:||  :|:|.....|.|||..|
 Worm   332 RNQVICEVDWIVPASSSPFRVTQLHR 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9117NP_608983.2 GloB 1..208 CDD:223565 47/210 (22%)
MBLAC1-like_MBL-fold 11..210 CDD:293797 46/207 (22%)
C25D7.5NP_506705.2 metallo-hydrolase-like_MBL-fold 182..351 CDD:390040 43/183 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23200
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.