DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9117 and swip-10

DIOPT Version :9

Sequence 1:NP_608983.2 Gene:CG9117 / 33846 FlyBaseID:FBgn0031766 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001359973.1 Gene:swip-10 / 180526 WormBaseID:WBGene00018738 Length:486 Species:Caenorhabditis elegans


Alignment Length:231 Identity:70/231 - (30%)
Similarity:103/231 - (44%) Gaps:46/231 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QVTVLQVGYSRQ---------------EEGDESAMRANCTCTLVRCRDGTNIIVDTLTAWDGDHL 60
            :|.||:.|.:.|               ::||:|        .||....||||...|       .|
 Worm   281 EVHVLRNGSAEQTIDGQYTFIASITLVKDGDKS--------ILVDTGLGTNINART-------EL 330

  Fly    61 RSLLGQQGLGVDDIHVVVCSHGHSDHIGCNYLFQKARMHLVGACASHHDLYMDHLGSGN-----P 120
            ...|...||...|:.:||.:|||.||:|..:.|..| :|       :|..|.......|     .
 Worm   331 IKSLEMHGLSPADVDIVVSTHGHPDHVGGVHDFPDA-LH-------YHGWYSHQRTKFNLTALFE 387

  Fly   121 DEQLALDSNAEVVVRRSPGHTLSCVSVLVENSQLGGRVGITGDLFERREDIDDENIWMDAGSENE 185
            ::.:.|..|..:|..|  |||...:.|:|...:..|.|.::||||.|.||||...:|... |.:.
 Worm   388 NDTMNLSENVMLVKCR--GHTSDDIGVVVRGVKRRGDVLVSGDLFMREEDIDHPMMWQPL-SADV 449

  Fly   186 KVQREERSKMAQLCEFIIPGHGPMFSVTQSMRCKLK 221
            ..||:.|.:...:.::|:||||.||.||.:::..||
 Worm   450 IAQRDSRRRYGCIVDWIVPGHGSMFQVTTNVKKALK 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9117NP_608983.2 GloB 1..208 CDD:223565 63/216 (29%)
MBLAC1-like_MBL-fold 11..210 CDD:293797 64/218 (29%)
swip-10NP_001359973.1 MBLAC1-like_MBL-fold 281..475 CDD:293797 65/219 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157614
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1139836at2759
OrthoFinder 1 1.000 - - FOG0005797
OrthoInspector 1 1.000 - - otm14309
orthoMCL 1 0.900 - - OOG6_106885
Panther 1 1.100 - - LDO PTHR23200
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2955
SonicParanoid 1 1.000 - - X4775
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.