DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9117 and C23H3.9

DIOPT Version :9

Sequence 1:NP_608983.2 Gene:CG9117 / 33846 FlyBaseID:FBgn0031766 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001379708.1 Gene:C23H3.9 / 173391 WormBaseID:WBGene00016022 Length:489 Species:Caenorhabditis elegans


Alignment Length:230 Identity:67/230 - (29%)
Similarity:109/230 - (47%) Gaps:37/230 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DPAQRNQVTVLQVGYSRQ-EEGDESAMRANCTCTLVRCRDGTNIIVDTLTAWDGDHLRSLLGQQG 68
            :|.....|||||.|..|. .:|...|:.|   .|||. .:|..:::||..:.|.:.|...|.::.
 Worm   265 EPKSYVNVTVLQAGSVRPLRDGQVEAVGA---ITLVN-DNGYIVLIDTGASSDTERLLHSLAKES 325

  Fly    69 LGVDDIHVVVCSHGHSDHIG-CNYLFQKARMHLVGACASHHDLYMDHLGSGNPDEQL------AL 126
            :.:|.|..||.:|....|:| .|:..||..:        :|.  |:::|......:|      .|
 Worm   326 VTLDQIDSVVITHASPGHMGNMNFFAQKPIL--------YHS--MEYIGRHVTPTELKERPYRKL 380

  Fly   127 DSNAEVVVRRSPGHTLSCVSVLVENSQLGGRVGITGDLF-------ERREDIDDENIWMDAGSEN 184
            ..|.|  |.::||||...:||||.|....|.:.|.|||.       |:|:.:.:|.:|.:|    
 Worm   381 SGNVE--VWKTPGHTQHDLSVLVHNVAGYGTMAIVGDLIPSEHLLSEKRDVMIEEGVWDNA---- 439

  Fly   185 EKVQREERSKMAQLCEFIIPGHGPMFSVTQSMRCK 219
              ::|:..:.:..:.::|:||||..|.|..:.|.|
 Worm   440 --IKRQNANLIVCMADWIVPGHGQPFRVLPNYRQK 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9117NP_608983.2 GloB 1..208 CDD:223565 62/217 (29%)
MBLAC1-like_MBL-fold 11..210 CDD:293797 62/213 (29%)
C23H3.9NP_001379708.1 Lustrin_cystein 81..124 CDD:405330
MBLAC1-like_MBL-fold 272..464 CDD:293797 62/213 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I8269
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1139836at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14309
orthoMCL 1 0.900 - - OOG6_106885
Panther 1 1.100 - - O PTHR23200
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2955
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.950

Return to query results.
Submit another query.