DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9109 and AT1G05280

DIOPT Version :9

Sequence 1:NP_001285650.1 Gene:CG9109 / 33844 FlyBaseID:FBgn0031765 Length:546 Species:Drosophila melanogaster
Sequence 2:NP_001318926.1 Gene:AT1G05280 / 837026 AraportID:AT1G05280 Length:491 Species:Arabidopsis thaliana


Alignment Length:334 Identity:65/334 - (19%)
Similarity:111/334 - (33%) Gaps:114/334 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 SASYICSTPTSVPNRKLPCLL-----------------------HA--------QPEEPLTLGQR 262
            |.:|..|:.:::..|.:.|:|                       ||        |.:.|      
plant     9 SKTYYSSSSSTIVTRMVNCILLFVFILLVYLLISASRLQSKNSIHAYFSSSDQDQSQSP------ 67

  Fly   263 RNGCEHTTGSHIYFAIKTCAKFHKERIPIIERTWAADARNRRYYSDVADVGIPAIGTGIPN---- 323
                  |...||.|.|.:.|...:.|...::..|  ||:..|        |...:...:|:    
plant    68 ------TKIEHIVFGIGSSAISWRARREYVKLWW--DAQKMR--------GCVFVERPLPSSQNH 116

  Fly   324 -----------------------------VQTGHCA-KTMAILQLSLKDIGKQLDIRWLMLVDDD 358
                                         ::...|. :|:.:...|.:      ::||.:..|||
plant   117 TDSYLLPPVCVSQDTSRFRYTWRGGDRNAIRIARCVLETVRLFNTSSE------EVRWYVFGDDD 175

  Fly   359 TLLSLHLIHTHLPTSVPRVSALLCRHNATELVYLGQRYG-YRLHAPDGFNYHTGGAGIVLSLPLV 422
            |:.        :|.::.|.   |.:::.|...|:|.... |..::..|.:...||.|..||..|.
plant   176 TIF--------IPENLART---LSKYDHTSWYYIGSTSEIYHQNSMFGHDMAFGGGGYALSSSLA 229

  Fly   423 RLIVQRC-SC----PSASAPDDMILGYCLQALGVPAIHVAGMHQARPQDYAGELLQLHA--PL-T 479
            .::.:.. ||    |.....|..:.. |:..|||......|.||...:..|..:|..|:  || :
plant   230 NVLARNFDSCIERYPHLYGGDSRVYA-CVLELGVGLSKEPGFHQFDVRGNALGILTSHSTRPLVS 293

  Fly   480 FHKFWNTDP 488
            .|...:.||
plant   294 LHHMAHIDP 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9109NP_001285650.1 Fringe 269..486 CDD:190308 53/259 (20%)
AT1G05280NP_001318926.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10811
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.