DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9109 and AT4G11350

DIOPT Version :9

Sequence 1:NP_001285650.1 Gene:CG9109 / 33844 FlyBaseID:FBgn0031765 Length:546 Species:Drosophila melanogaster
Sequence 2:NP_192874.2 Gene:AT4G11350 / 826737 AraportID:AT4G11350 Length:507 Species:Arabidopsis thaliana


Alignment Length:304 Identity:76/304 - (25%)
Similarity:123/304 - (40%) Gaps:77/304 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 ILLKSASYICSTPTSVPNRKLPC-------LLHAQPEE---PLTLGQRRNGCEHTTGSHIYFAIK 279
            ||..|.:||..| ..:.:...||       :|..:||:   .:|:.......|.|..:|:.|.|.
plant    34 ILFISVTYIIYT-LKIVSTTHPCEDLTSESILQQRPEKKAVTVTVKAVPAEQEATDLNHVVFGIA 97

  Fly   280 TCAKFHKERIPIIERTWAADARNRRYYSDVADVGIPAIGTG----IPNV-------------QTG 327
            ..:|..|:|...| :.|....:.|.|.....:|.|.: .||    :|:|             :.|
plant    98 ASSKLWKQRKEYI-KIWYKPKKMRGYVWLDEEVKIKS-ETGDQESLPSVRISGDTSSFPYTNKQG 160

  Fly   328 H-----CAKTMAILQLSLKDIGKQLDIRWLMLVDDDTL-LSLHLIHTHLPTSVPRVSALLCRHNA 386
            |     .::.::...:||....|: ::||.::.||||: ::.:||.            :|.:::.
plant   161 HRSAIRISRIVSETLMSLDSESKK-NVRWFVMGDDDTVFVTDNLIR------------VLRKYDH 212

  Fly   387 TELVYLGQR---------YGYRLHAPDGFNYHTGGAGIVLSLPL-VRLIVQRCSC----PSASAP 437
            .::.|:|..         :.|      |..|  ||.|..:|.|| |.|...:..|    |:....
plant   213 EQMYYIGSLSESHLQNIIFSY------GMAY--GGGGFAISYPLAVALSKMQDQCIQRYPALYGS 269

  Fly   438 DDMILGYCLQALGVPAIHVAGMHQARPQDYAGELLQLHA--PLT 479
            ||.:.. |:..||||.....|.||   .|..|.|..|.|  |:|
plant   270 DDRMQA-CMAELGVPLTKEIGFHQ---YDVHGNLFGLLAAHPIT 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9109NP_001285650.1 Fringe 269..486 CDD:190308 63/250 (25%)
AT4G11350NP_192874.2 Galactosyl_T 87..292 CDD:389837 54/228 (24%)
DUF604 227..480 CDD:368036 30/95 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10811
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.