DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9109 and AT3G11420

DIOPT Version :9

Sequence 1:NP_001285650.1 Gene:CG9109 / 33844 FlyBaseID:FBgn0031765 Length:546 Species:Drosophila melanogaster
Sequence 2:NP_187749.1 Gene:AT3G11420 / 820315 AraportID:AT3G11420 Length:505 Species:Arabidopsis thaliana


Alignment Length:373 Identity:76/373 - (20%)
Similarity:125/373 - (33%) Gaps:136/373 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 YPMLSAGVVFTGALLRRLADLVAPSGQNITVHSDFSIDASHELARFIFDNVSPDPHISTPISGGI 225
            :.:|:..:|....:||  |..::||.:      |:|.....:|      ...|...|:.|.|..:
plant    38 FSVLTCLIVSVSLVLR--ATFLSPSAR------DYSTTYGLKL------TAVPQKAIALPPSASV 88

  Fly   226 LLKSASYICSTPTSVPNRKLPCLLHAQPEEPLTLGQRRNGCEHTTGSHIYFAIKTCAKFHKERIP 290
                      .||::                               |||:|:|...|:...:|..
plant    89 ----------GPTNI-------------------------------SHIFFSIAGAAETWIDRSQ 112

  Fly   291 IIERTWAADARNRRYYSDVADVGIPA----IGTGIP-----------NVQTGHCAKTMAIL---- 336
            .|...|....|...:..:  .|.||.    :...||           ...:...|..:|.:    
plant   113 YISLWWRNTTRGFVWLDE--PVKIPENHSDVRFSIPTRVSDPGWTRFKFSSSRAAVRIARIIWDS 175

  Fly   337 -QLSLKDIGKQLDIRWLMLVDDDTLLSLHLIHTHLPTSVPRVSALLCRHNATELVYLGQRYGYR- 399
             :|:|.      ::||.::.||||:.           ....:..:|.:::..::.|:|   |.. 
plant   176 YRLNLP------NVRWFVMGDDDTVF-----------FTENLVKVLSKYDHEQMWYIG---GNSE 220

  Fly   400 ------LHAPDGFNYHTGGAGIVLSLPLVRLIVQRCSCPSASAPDDMILGY------------CL 446
                  :||   ::...||.|..||.||...:        |:|.||.:..|            |:
plant   221 SVEQDVMHA---YDMAFGGGGFALSRPLAARL--------AAAMDDCLQRYFYFYGSDQRIASCI 274

  Fly   447 QALGVPAIHVAGMHQARPQDYAGE---LLQLH--APL-TFHKFWNTDP 488
            ..:|||.....|.||.   |..|:   .|..|  ||| :.|.....||
plant   275 SEIGVPFTEERGFHQL---DIRGDPYGFLAAHPLAPLVSLHHLVYLDP 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9109NP_001285650.1 Fringe 269..486 CDD:190308 58/261 (22%)
AT3G11420NP_187749.1 Galactosyl_T <181..>242 CDD:304462 15/83 (18%)
DUF604 224..477 CDD:282497 31/110 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10811
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.