DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9109 and C1galt1

DIOPT Version :9

Sequence 1:NP_001285650.1 Gene:CG9109 / 33844 FlyBaseID:FBgn0031765 Length:546 Species:Drosophila melanogaster
Sequence 2:XP_038964253.1 Gene:C1galt1 / 65044 RGDID:621105 Length:371 Species:Rattus norvegicus


Alignment Length:345 Identity:73/345 - (21%)
Similarity:118/345 - (34%) Gaps:119/345 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 LLRRLADLVAPSGQNITVHSDFSIDASHELARFIFD-NVSPDPH--ISTPISGGILLKSASYICS 235
            ||:..|| |.|:..:...|:..|.|:.|...:...| |.....|  .:|.::.. |.:....:|.
  Rat    38 LLQEQAD-VQPNMLHNDPHARHSDDSGHNHLKGQMDFNADSSQHKDENTDVAEN-LYQKVKVLCW 100

  Fly   236 TPTSVPNRKLPCLLHAQPEEPLTLGQRRNGCEHTTGSHIYFAIKTCAKFHKERIPIIERTWAADA 300
            ..||..|                                   ::..||.       ::.|||...
  Rat   101 VMTSPQN-----------------------------------LEKKAKH-------VKATWAQRC 123

  Fly   301 RNRRYYSDVADVGIPAIGTGIPNVQTGHCAKTMAILQLSLKDIGKQL-----------------D 348
            ....:.|...:...|.:|                   |..|:..:||                 |
  Rat   124 NKVLFMSSEENKDFPTVG-------------------LETKEGREQLYWKTIKAFQYVHDHYLED 169

  Fly   349 IRWLMLVDDDTLLSLHLIHTHLPTSVPRVSALLCRHNATELVYLGQRYGYRLHAPDGFNYHTGGA 413
            ..|.|..||||.:.|           ..:..||.::|..:.:|.|:|  ::.:...|  |.:|||
  Rat   170 ADWFMKADDDTYVIL-----------DNLRWLLSKYNPEQPIYFGRR--FKPYVKQG--YMSGGA 219

  Fly   414 GIVLSLPLVRLIVQRC---SCPSASAPDDMILGYCLQALGVPAIHVAG----------MHQARPQ 465
            |.|||...:|..|...   .|..:|:.:|:.||.|::.:.|.    ||          .|...|:
  Rat   220 GYVLSKEALRRFVDAFKTEKCTHSSSIEDLALGRCMEIIKVE----AGDSRDPTGKETFHPFVPE 280

  Fly   466 DYAGELLQLHAPLTFHKFWN 485
            .:   |::.:.|.||. :||
  Rat   281 HH---LIKGYLPKTFW-YWN 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9109NP_001285650.1 Fringe 269..486 CDD:190308 54/247 (22%)
C1galt1XP_038964253.1 Galactosyl_T 115..>256 CDD:419759 41/174 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.