DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9109 and C1GALT1

DIOPT Version :9

Sequence 1:NP_001285650.1 Gene:CG9109 / 33844 FlyBaseID:FBgn0031765 Length:546 Species:Drosophila melanogaster
Sequence 2:NP_064541.1 Gene:C1GALT1 / 56913 HGNCID:24337 Length:363 Species:Homo sapiens


Alignment Length:274 Identity:63/274 - (22%)
Similarity:105/274 - (38%) Gaps:58/274 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 PCLLHAQPEEPLTLGQRRNGCEHTTGSHIYFAIKTCAK----------FHKERI----------- 289
            |.:||   .:|.......||..|..|...:.|..:..|          :.|.||           
Human    39 PNVLH---NDPHARHSDDNGQNHLEGQMNFNADSSQHKDENTDIAENLYQKVRILCWVMTGPQNL 100

  Fly   290 ----PIIERTWAADARNRRYYSDVADVGIPAIGTGIPNVQTGHCAKTMAILQLSLKDIGKQLDIR 350
                ..::.|||.......:.|...:...||:|......:.....||:...|...:...:..|  
Human   101 EKKAKHVKATWAQRCNKVLFMSSEENKDFPAVGLKTKEGRDQLYWKTIKAFQYVHEHYLEDAD-- 163

  Fly   351 WLMLVDDDTLLSLHLIHTHLPTSVPRVSALLCRHNATELVYLGQRYGYRLHAPDGFNYHTGGAGI 415
            |.:..||||.:.|           ..:..||.:::..|.:|.|:|  ::.:...|  |.:||||.
Human   164 WFLKADDDTYVIL-----------DNLRWLLSKYDPEEPIYFGRR--FKPYVKQG--YMSGGAGY 213

  Fly   416 VLSLPLVRLIV---QRCSCPSASAPDDMILGYCLQALGVPA------IHVAGMHQARPQDYAGEL 471
            |||...::..|   :...|..:|:.:|:.||.|::.:.|.|      |.....|...|:.:   |
Human   214 VLSKEALKRFVDAFKTDKCTHSSSIEDLALGRCMEIMNVEAGDSRDTIGKETFHPFVPEHH---L 275

  Fly   472 LQLHAPLTFHKFWN 485
            ::.:.|.||. :||
Human   276 IKGYLPRTFW-YWN 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9109NP_001285650.1 Fringe 269..486 CDD:190308 56/251 (22%)
C1GALT1NP_064541.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..72 8/33 (24%)
Galactosyl_T 107..>221 CDD:328824 32/130 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.