DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9109 and c1galt1a

DIOPT Version :9

Sequence 1:NP_001285650.1 Gene:CG9109 / 33844 FlyBaseID:FBgn0031765 Length:546 Species:Drosophila melanogaster
Sequence 2:NP_001070842.1 Gene:c1galt1a / 557675 ZFINID:ZDB-GENE-061013-303 Length:408 Species:Danio rerio


Alignment Length:215 Identity:56/215 - (26%)
Similarity:89/215 - (41%) Gaps:46/215 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 IERTWAADARNRRYYSDVADVGIPAIGTGIPNVQTGHCAKTMAILQLSLKDIGKQLDIRWLMLVD 356
            ::.||:.......:.|...|...|.:|.|....:.....||:.....:||:.|.:.|  |.:..|
Zfish   112 VKNTWSRHCNVVLFMSSEEDRSFPTVGLGTGEGRDQLYWKTIRAFHYALKNHGHEAD--WFLKAD 174

  Fly   357 DDTLLSLHLIHTHLPTSVPRVSALLCRHNATELVYLGQRYGYRLHAPDGFNYHTGGAGIVLSLPL 421
            |||.:           .|..:..:|..:...:.:|.|:|  ::.:...|  |.:||||.|||...
Zfish   175 DDTFV-----------VVDNLRWILSNYTPEQPIYFGKR--FKPYTKQG--YMSGGAGYVLSKEA 224

  Fly   422 VRLIVQRCS---CPSASAPDDMILGYCLQALGVPAIHVAGMHQARPQDYAGELLQLHAPLTFHKF 483
            :|..|:..|   |...:..:|:.:|.||:.:||    :||  .:|.        .||.. |||.|
Zfish   225 LRRFVEGFSTKVCTHTTPVEDLAMGQCLEKMGV----LAG--DSRD--------SLHRE-TFHPF 274

  Fly   484 WNTDPEH--------TYRRW 495
               .|||        |:..|
Zfish   275 ---IPEHHLTGKFSKTFWYW 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9109NP_001285650.1 Fringe 269..486 CDD:190308 51/196 (26%)
c1galt1aNP_001070842.1 Galactosyl_T <169..292 CDD:304462 43/156 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 356..408
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.