Sequence 1: | NP_001285650.1 | Gene: | CG9109 / 33844 | FlyBaseID: | FBgn0031765 | Length: | 546 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001070842.1 | Gene: | c1galt1a / 557675 | ZFINID: | ZDB-GENE-061013-303 | Length: | 408 | Species: | Danio rerio |
Alignment Length: | 215 | Identity: | 56/215 - (26%) |
---|---|---|---|
Similarity: | 89/215 - (41%) | Gaps: | 46/215 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 292 IERTWAADARNRRYYSDVADVGIPAIGTGIPNVQTGHCAKTMAILQLSLKDIGKQLDIRWLMLVD 356
Fly 357 DDTLLSLHLIHTHLPTSVPRVSALLCRHNATELVYLGQRYGYRLHAPDGFNYHTGGAGIVLSLPL 421
Fly 422 VRLIVQRCS---CPSASAPDDMILGYCLQALGVPAIHVAGMHQARPQDYAGELLQLHAPLTFHKF 483
Fly 484 WNTDPEH--------TYRRW 495 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9109 | NP_001285650.1 | Fringe | 269..486 | CDD:190308 | 51/196 (26%) |
c1galt1a | NP_001070842.1 | Galactosyl_T | <169..292 | CDD:304462 | 43/156 (28%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 356..408 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2246 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |