DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9109 and si:dkey-202e17.1

DIOPT Version :9

Sequence 1:NP_001285650.1 Gene:CG9109 / 33844 FlyBaseID:FBgn0031765 Length:546 Species:Drosophila melanogaster
Sequence 2:XP_005170092.1 Gene:si:dkey-202e17.1 / 555344 ZFINID:ZDB-GENE-060503-810 Length:316 Species:Danio rerio


Alignment Length:234 Identity:54/234 - (23%)
Similarity:93/234 - (39%) Gaps:36/234 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 TLGQRRNG-CEHTTGSHIYFAIKTCAKFHKERIPIIERTWAADARNRRYYSDVADVGIPAIGTGI 321
            |:.|.||. .:.:....:...:.|..:..:.|...:..||........|.:. .:...|.||..:
Zfish    48 TVAQNRNATLDSSQKVRVLCWVMTQPQNLQSRTQHVHATWGKRCDTILYMTS-KNTDFPTIGLNV 111

  Fly   322 PNVQTGHCAKTMAILQLSLK---DIGKQLDIRWLMLVDDDTLLSL-HLIHTHLPTSVPRVSALLC 382
            ...:.....||:...|...|   |     |..|.:..||||.:.: :|.|:            |.
Zfish   112 SEGRNQLYWKTIRAFQYIHKHHLD-----DADWFLKADDDTFVVIENLRHS------------LS 159

  Fly   383 RHNATELVYLGQRYGYRLHAPDGFNYHTGGAGIVLSLPLVRLIVQRCS---CPSASAPDDMILGY 444
            :|::.:.:|.|:|  :|.....|  |.:||||.|||...:|..|:..:   |...:..:|:.:|.
Zfish   160 KHSSEDPLYFGRR--FRPFVAQG--YMSGGAGYVLSKEALRRFVKGFADGLCTHTTELEDVGMGQ 220

  Fly   445 CLQALGV---PAIHVAG---MHQARPQDYAGELLQLHAP 477
            |::.:.|   .:..|.|   .|...|.:|....|:...|
Zfish   221 CMEKMKVEMGDSRDVFGRQVFHPYPPGNYLVRQLRRQRP 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9109NP_001285650.1 Fringe 269..486 CDD:190308 50/222 (23%)
si:dkey-202e17.1XP_005170092.1 Galactosyl_T <139..>229 CDD:304462 29/105 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.