DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9109 and fng

DIOPT Version :9

Sequence 1:NP_001285650.1 Gene:CG9109 / 33844 FlyBaseID:FBgn0031765 Length:546 Species:Drosophila melanogaster
Sequence 2:NP_524191.1 Gene:fng / 40314 FlyBaseID:FBgn0011591 Length:412 Species:Drosophila melanogaster


Alignment Length:446 Identity:99/446 - (22%)
Similarity:149/446 - (33%) Gaps:168/446 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 PQRF----PYPMLSAGVVFTGALLRRLA-----------DLVAPSGQNITVHSDFSIDASHELAR 205
            ||||    ...||:..||:...||.:.|           .:.|.:.:.:|.|.|          :
  Fly    10 PQRFKRILQAMMLAVAVVYMTLLLYQSAYGYPGIQVPHSQVDALASEAVTTHRD----------Q 64

  Fly   206 FIFDNVSPDPHISTPISGGILLKSASYICSTPTSVPNRK----------------LPCLL----- 249
            .:.|.|..    |||...|....:||     ||:|..||                ...||     
  Fly    65 LLQDYVQS----STPTQPGAGAPAAS-----PTTVIIRKDIRSFNFSDIEVSERPTATLLTELAR 120

  Fly   250 ----------------HAQPEEPLTLGQRRNGCEHTTGSHIYFAIKTCAKFHKERIPIIERTWAA 298
                            .|.|:.|:           |....|:.::||...:|..|:.:|.:||..
  Fly   121 RSRNGELLRDLSQRAVTATPQPPV-----------TELDDIFISVKTTKNYHDTRLALIIKTWFQ 174

  Fly   299 DARNR---------RYYSDVADVGIPAIGTGIPNVQTGH-----CAKTMAILQLSLKDIGKQLDI 349
            .||::         .||.:.....:  |.|   ....||     |.|..|.|.:.|:. ||    
  Fly   175 LARDQTWFFTDTDDHYYQEKTKGHL--INT---KCSQGHFRKALCCKMSAELDVFLES-GK---- 229

  Fly   350 RWLMLVDDDTLLSLHLIHTHLPTSVPRVSALLCRHNATELVYLGQRYGYRLHAP-----DGFN-- 407
            :|....|||..:           :|||:..||..::.:...|||:.   .:.:|     |..|  
  Fly   230 KWFCHFDDDNYV-----------NVPRLVKLLDEYSPSVDWYLGKP---SISSPLEIHLDSKNTT 280

  Fly   408 --------YHTGGAGIVLSLPLVRLIVQRCSCPSASA------------PDDMILGYCLQ-ALGV 451
                    :.|||||..||..|...::     |.|..            |||:.:|:.:: .|.|
  Fly   281 TNKKITFWFATGGAGFCLSRALTLKML-----PIAGGGKFISIGDKIRFPDDVTMGFIIEHLLKV 340

  Fly   452 PAIHVAGMH-QARPQDY-AGELLQLHAPLTFHKF---WN----------TDPEHTY 492
            |...|...| ...|.:: ..:..|.....::...   ||          |||:..|
  Fly   341 PLTVVDNFHSHLEPMEFIRQDTFQDQVSFSYAHMKNQWNVIKVDGFDMKTDPKRFY 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9109NP_001285650.1 Fringe 269..486 CDD:190308 62/273 (23%)
fngNP_524191.1 Fringe 145..394 CDD:190308 65/277 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461282
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.