DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9109 and CG34056

DIOPT Version :9

Sequence 1:NP_001285650.1 Gene:CG9109 / 33844 FlyBaseID:FBgn0031765 Length:546 Species:Drosophila melanogaster
Sequence 2:NP_001033979.1 Gene:CG34056 / 38106 FlyBaseID:FBgn0054056 Length:341 Species:Drosophila melanogaster


Alignment Length:224 Identity:58/224 - (25%)
Similarity:91/224 - (40%) Gaps:35/224 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 IKTCAKFHKERIPIIERTWAADARNRRYYSDVADVGIPAIGTGIPNVQTGHCAKTMAILQLSLKD 342
            :.|..|.|:.|:..::.||........:.|...|..:..|..|:|..:.....|....|:...::
  Fly    67 VLTLPKNHQSRVRRVKGTWGRRCNKLIFISSQEDRELGVIDVGVPEDRNNLYLKMRKALEYVYRN 131

  Fly   343 IGKQLDIRWLMLVDDDTLLSLHLIHTHLPTSVPRVSALLCRHNATELVYLGQRYGYRLHAPDGFN 407
            .|:..|  |.:..||||.:.:.           .:..||..::....:|.|.|  :|...|.|  
  Fly   132 HGEDYD--WFLKADDDTFVIME-----------NLRFLLYPYDPEAALYFGHR--FRTTFPQG-- 179

  Fly   408 YHTGGAGIVLSLPLVR---LIVQRCS--CPSASAPDDMILGYCLQALGVPAIHVAGMHQARPQDY 467
            |.:||||.|:|...:|   |.....|  ||..:..:|..:|:|||.:||    |||  .:|.::.
  Fly   180 YMSGGAGYVMSRDALRRLNLFAFNNSQFCPINNNSEDRQIGFCLQNVGV----VAG--DSRDEEG 238

  Fly   468 AGELLQLHAPLTFHKFWNTDPEHTYRRWL 496
            ....|    ||:......|.|..   .||
  Fly   239 RDRFL----PLSLKFMLPTFPTD---NWL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9109NP_001285650.1 Fringe 269..486 CDD:190308 54/212 (25%)
CG34056NP_001033979.1 Galactosyl_T 67..>226 CDD:304462 45/175 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.