DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9109 and CG3119

DIOPT Version :9

Sequence 1:NP_001285650.1 Gene:CG9109 / 33844 FlyBaseID:FBgn0031765 Length:546 Species:Drosophila melanogaster
Sequence 2:NP_608717.2 Gene:CG3119 / 33479 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster


Alignment Length:160 Identity:37/160 - (23%)
Similarity:56/160 - (35%) Gaps:39/160 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 DIRWLMLVDDDTLLSL----HLIHTHLPTSVPRVSALLCRHNATELVYLGQRYGYRLHAPDGFNY 408
            |..|.:..||||.:.:    ||:....|.:.......:.|:|.                    :|
  Fly   137 DYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSRYNV--------------------SY 181

  Fly   409 HTGGAGIVLSL-PLVRLIVQR------CSCPSASAPDDMILGYCLQALGVPAIHVAGMHQARPQD 466
            .:|||..:||. .|.|...|.      |..|.....:|..:|.|:|.:||   |......|...|
  Fly   182 MSGGASYILSREALHRFATQAYESEVICPQPKKMGIEDFYMGICMQNVGV---HFVDSTHALDGD 243

  Fly   467 YAGELLQLHAPLTFHKFWNTDPEHTYRRWL 496
            ...:.:    ||....:. :|..:|...||
  Fly   244 TKPKFM----PLDLENYM-SDANYTIPEWL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9109NP_001285650.1 Fringe 269..486 CDD:190308 33/148 (22%)
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 29/120 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.