DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9109 and C1GALT1C1

DIOPT Version :9

Sequence 1:NP_001285650.1 Gene:CG9109 / 33844 FlyBaseID:FBgn0031765 Length:546 Species:Drosophila melanogaster
Sequence 2:NP_001011551.1 Gene:C1GALT1C1 / 29071 HGNCID:24338 Length:318 Species:Homo sapiens


Alignment Length:157 Identity:31/157 - (19%)
Similarity:56/157 - (35%) Gaps:26/157 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 AIGTGIPNVQTGHCAKTMAILQLSLK---DIGKQLDIRWLML------VDDDTLLSLHLIHTHLP 371
            ::...:....|.||.|.......::|   .|....:..|||:      ..|......:......|
Human    81 SLWAAVKETWTKHCDKAEFFSSENVKVFESINMDTNDMWLMMRKAYKYAFDKYRDQYNWFFLARP 145

  Fly   372 TS---VPRVSALLCRHNATELVYLGQRYGYRLHAPDGFNYHTGGAGIVLSLPLVRLIVQRCS--- 430
            |:   :..:...|.:.:.::..||    |:.:.:.| ..|.....|||||:..::.:....:   
Human   146 TTFAIIENLKYFLLKKDPSQPFYL----GHTIKSGD-LEYVGMEGGIVLSVESMKRLNSLLNIPE 205

  Fly   431 -CPSASA-----PDDMILGYCLQALGV 451
             ||....     .:|..|..||:..||
Human   206 KCPEQGGMIWKISEDKQLAVCLKYAGV 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9109NP_001285650.1 Fringe 269..486 CDD:190308 31/157 (20%)
C1GALT1C1NP_001011551.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.