DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9109 and bus-4

DIOPT Version :9

Sequence 1:NP_001285650.1 Gene:CG9109 / 33844 FlyBaseID:FBgn0031765 Length:546 Species:Drosophila melanogaster
Sequence 2:NP_500615.2 Gene:bus-4 / 188726 WormBaseID:WBGene00044620 Length:368 Species:Caenorhabditis elegans


Alignment Length:237 Identity:56/237 - (23%)
Similarity:91/237 - (38%) Gaps:42/237 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 TGSHIYFAIKTCAKFHKERIPIIERTW--AADARNRRYYSD---VADVGIPAIGTGIPNVQTGHC 329
            :||.:.:|: |.:.:||.|:|.|..||  ..||.:....||   .|......:..|:|.......
 Worm    95 SGSLLCWAM-TTSIYHKTRVPAITETWLRRCDAGHLFTNSDRFLNASTPYHTVFDGLPESYYKLF 158

  Fly   330 AKTMAILQLSLKDIGKQLDIRWLMLVDDDTLLSLHLIHTHLPTSVPRVSALLCRHNATELVYLGQ 394
            .||...|....|.:.|..|  |....||||.|.:..:..:|.|..|.....:             
 Worm   159 WKTRLALLYIYKYVSKDFD--WYFKGDDDTYLIVENLQRYLATLDPNKPYFI------------- 208

  Fly   395 RYGYRLHAPDGFNYHTGGAGIVLSLPLVRLIVQRCSCPSASAP----DDMILGYCLQALGVPAI- 454
              ||||.......|:.||:|.|:|...:|:..::........|    :|..:..||.::|:..: 
 Worm   209 --GYRLSRRTETGYNAGGSGYVMSREAMRIFAEKLFNDKQKCPYHEWEDYAIAQCLASVGIVPLD 271

  Fly   455 --HVAGMHQARP----QDYAGEL--------LQLHAPLTFHK 482
              ...|..:..|    |.:..:|        :|:..|..:|:
 Worm   272 SRDEKGRQRFLPWRPEQHFYADLTRSFQMDPIQVWGPAIYHE 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9109NP_001285650.1 Fringe 269..486 CDD:190308 56/237 (24%)
bus-4NP_500615.2 Galactosyl_T 104..>235 CDD:304462 40/147 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.