DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9109 and C16D9.6

DIOPT Version :9

Sequence 1:NP_001285650.1 Gene:CG9109 / 33844 FlyBaseID:FBgn0031765 Length:546 Species:Drosophila melanogaster
Sequence 2:NP_505126.2 Gene:C16D9.6 / 182687 WormBaseID:WBGene00015861 Length:340 Species:Caenorhabditis elegans


Alignment Length:229 Identity:52/229 - (22%)
Similarity:88/229 - (38%) Gaps:43/229 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 IKTCAKFHKERIPIIERTWAADARNRRYYSD--VADVGIP--AIGTGIPNVQTGHCAKTMAILQL 338
            ::|...:|..|...|..||.....:.:.::.  ..|..||  .:..|||:.......|:......
 Worm   102 VQTSTIYHDTRSLAINETWIHRCDHGQLFTSERFNDTRIPYSTVFKGIPDDYYNLFFKSRYAFHH 166

  Fly   339 SLKDIGKQLDIRWLMLVDDDTLLSLHLIHTHLPTSVPRVSALLCRHNATELVYLGQRYGYRLHAP 403
            ...:|..:.|  |.:..||||.:.:..:.:.|.|.           |..|..|||  |..:.:..
 Worm   167 IYTNISSEFD--WYLKADDDTFVIVENLRSFLSTL-----------NPDEPHYLG--YVLKPYLK 216

  Fly   404 DGFNYHTGGAGIVLSLPLVRLIVQRCSCPSASAPDDMI----LGYCLQALGVPAIHVAGMHQARP 464
            :|:|  .||||.:||...:::..::....:...|||:.    :..||..        |||:   |
 Worm   217 NGYN--AGGAGYILSRAALKIFSEQLYSNATLCPDDIYEDVGIARCLAN--------AGMY---P 268

  Fly   465 QDYAGELLQLHAPLTFHKFWNTDPEHTYRRWLGG 498
            :|....|.|       ::|....|..|:.:...|
 Worm   269 EDTRNSLGQ-------NRFNTFSPSDTFHQTKAG 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9109NP_001285650.1 Fringe 269..486 CDD:190308 49/215 (23%)
C16D9.6NP_505126.2 Galactosyl_T 98..>250 CDD:304462 37/164 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.