DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9109 and Y38C1AB.1

DIOPT Version :9

Sequence 1:NP_001285650.1 Gene:CG9109 / 33844 FlyBaseID:FBgn0031765 Length:546 Species:Drosophila melanogaster
Sequence 2:NP_499857.3 Gene:Y38C1AB.1 / 176823 WormBaseID:WBGene00021403 Length:261 Species:Caenorhabditis elegans


Alignment Length:271 Identity:58/271 - (21%)
Similarity:94/271 - (34%) Gaps:76/271 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 ILLKSASYICSTPTSVPNRKLPCLLHAQPEEPLTLGQRRNGCEHTTGSHIYFAIKTCAKFHKERI 289
            :.|...|.|...|.::     .||:|                             |....|:.|.
 Worm     7 VFLSQISLILGAPQTI-----LCLIH-----------------------------TATPSHETRA 37

  Fly   290 PIIERTWAADARNRRYYSD-VADVGIPAIGTGIPNVQTGHCAKTMAILQLSLKDIGKQLDIRWLM 353
            ..|..||.....:..:::| ..:..||.|...:.|.:.....|...:.:.....|.|:.|  |..
 Worm    38 KTILETWVQHCDDFLFFTDSKMNDSIPHIYYPLLNSRDHSWEKIRRVFKYVRDKITKKYD--WYY 100

  Fly   354 LVDDDTLLSLHLIHTHLPTSVPRVSALLCRHNATELVYLGQRYGYRLHAPDGFNYHTGGAGIVLS 418
            ..||||...:|.:.|           ||..::.|:..|||.::.:  ..|.|||   .|:..:||
 Worm   101 RADDDTYALMHNMRT-----------LLDNYSPTKHHYLGLQWNF--FTPRGFN---DGSSYILS 149

  Fly   419 LPLV----RLIVQRCSCPS-ASAPDDMILGYCLQALGVPAIHVAGMHQARPQDYAGEL----LQL 474
            .|.:    .:::....||. ..|.:|..|..||..:           :..|:|...|:    :|.
 Worm   150 RPTMEAFNEVMLDPDRCPDHHRAEEDQELAKCLAHM-----------EIYPEDIRDEMGSERIQH 203

  Fly   475 HAP---LTFHK 482
            ..|   ||.:|
 Worm   204 FHPLEQLTIYK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9109NP_001285650.1 Fringe 269..486 CDD:190308 51/227 (22%)
Y38C1AB.1NP_499857.3 Galactosyl_T 33..>129 CDD:304462 25/108 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.