DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9107 and AT5G38720

DIOPT Version :9

Sequence 1:NP_608981.1 Gene:CG9107 / 33843 FlyBaseID:FBgn0031764 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001332268.1 Gene:AT5G38720 / 833863 AraportID:AT5G38720 Length:325 Species:Arabidopsis thaliana


Alignment Length:185 Identity:52/185 - (28%)
Similarity:91/185 - (49%) Gaps:35/185 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 EKNSSIGKALALKSIDLFN---------------SSGECIVKTGMELWHEEYDCNY-----LLDA 154
            ::.|...|:...|.:|:.:               |||:.....||:.|..:|   |     |.:.
plant   148 KRESKFKKSNKKKKMDMTSKKENKIEEEEDVYQISSGDEDCTRGMKKWVSDY---YEGRPGLDEL 209

  Fly   155 QKTKLQISKYMAGYDKRERAAAQAAKTGEADADGW-VTVGKEGRNAGFE-QKASVIG-----RLE 212
            ||   :|..:|..:::|.....| .|..:|...|| |.|..:||....| :..:.:|     .||
plant   210 QK---RIDDFMTAHEERLEQEKQ-DKEAKAAEGGWTVVVHHKGRKKTTESETGTAVGSFSQAALE 270

  Fly   213 EKVAKGNKTKELKN-FYTFQIRESKMQNIVEMRKKFEEEKRKIGLLKQSRRFKPF 266
            :|:||..:::.:.: ||.||.|:::...::.::.||||:|::|..|:.:||||||
plant   271 DKIAKKKQSEPVAHGFYRFQRRDAQRNELLALQSKFEEDKKRIQQLRAARRFKPF 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9107NP_608981.1 RRM_Rrp7A 42..146 CDD:240740 10/50 (20%)
RRP7_Rrp7A 138..266 CDD:240578 43/140 (31%)
AT5G38720NP_001332268.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 58 1.000 Domainoid score I3973
eggNOG 1 0.900 - - E1_KOG4008
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004160
OrthoInspector 1 1.000 - - oto2970
orthoMCL 1 0.900 - - OOG6_103832
Panther 1 1.100 - - LDO PTHR13191
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.770

Return to query results.
Submit another query.