DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9107 and RRP7A

DIOPT Version :9

Sequence 1:NP_608981.1 Gene:CG9107 / 33843 FlyBaseID:FBgn0031764 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_056518.2 Gene:RRP7A / 27341 HGNCID:24286 Length:280 Species:Homo sapiens


Alignment Length:264 Identity:95/264 - (35%)
Similarity:153/264 - (57%) Gaps:8/264 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GYVVVPLRTTPKAQHCHSIYMREHFIRLMDPNK-PKGRTLFLLNVPPYVTEDSLRTVFGRAGSIE 69
            ||..:|::.:.|.|..|.:|:|.|.:|....:. |:.||||:||||||.||:||..:....|.::
Human    22 GYAAIPIKFSEKQQASHYLYVRAHGVRQGTKSTWPQKRTLFVLNVPPYCTEESLSRLLSTCGLVQ 86

  Fly    70 AVEFAAKPGKEETIKWYEGTGEPFSNTRPPFVFKVAYIVFEKNSSIGKALALKSIDLFNSSGECI 134
            :||...||...|:.|   .:...|.:.:|...|:|||:||:|.|.:..|||||. .|..|:....
Human    87 SVELQEKPDLAESPK---ESRSKFFHPKPVPGFQVAYVVFQKPSGVSAALALKG-PLLVSTESHP 147

  Fly   135 VKTGMELWHEEYDCNYLLDAQKTKLQISKYMAGYDKR--ERAAAQAAKTGEADADGWVTVGKEGR 197
            ||:|:..|..:| .:.:.|.:..::::..:|..||::  |..|....:.|..|.:|||.|.:.||
Human   148 VKSGIHKWISDY-ADSVPDPEALRVEVDTFMEAYDQKIAEEEAKAKEEEGVPDEEGWVKVTRRGR 211

  Fly   198 NAGFEQKASVIGRLEEKVAKGNKTKELKNFYTFQIRESKMQNIVEMRKKFEEEKRKIGLLKQSRR 262
            .....:..:...|:.|:..:....|||.|||.:|.|||||:::.::||||||:|::|.||:..|:
Human   212 RPVLPRTEAASLRVLERERRKRSRKELLNFYAWQHRESKMEHLAQLRKKFEEDKQRIELLRAQRK 276

  Fly   263 FKPF 266
            |:|:
Human   277 FRPY 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9107NP_608981.1 RRM_Rrp7A 42..146 CDD:240740 42/103 (41%)
RRP7_Rrp7A 138..266 CDD:240578 43/129 (33%)
RRP7ANP_056518.2 RRM_Rrp7A 59..159 CDD:240740 42/103 (41%)
RRP7_Rrp7A 151..280 CDD:240578 43/129 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143584
Domainoid 1 1.000 86 1.000 Domainoid score I8099
eggNOG 1 0.900 - - E1_KOG4008
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41060
Inparanoid 1 1.050 167 1.000 Inparanoid score I4168
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59387
OrthoDB 1 1.010 - - D1607176at2759
OrthoFinder 1 1.000 - - FOG0004160
OrthoInspector 1 1.000 - - otm41972
orthoMCL 1 0.900 - - OOG6_103832
Panther 1 1.100 - - LDO PTHR13191
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1225
SonicParanoid 1 1.000 - - X5976
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.