DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13996 and Samd15

DIOPT Version :9

Sequence 1:NP_608980.1 Gene:CG13996 / 33842 FlyBaseID:FBgn0031763 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001382553.1 Gene:Samd15 / 681908 RGDID:1589368 Length:574 Species:Rattus norvegicus


Alignment Length:249 Identity:51/249 - (20%)
Similarity:80/249 - (32%) Gaps:102/249 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PHSASGMDSPDICEPPQDEQEFCFRYPSYMFPDVE--YDKEDVPLPFK----------------- 62
            |...:.:|.|:..|..|..:: ..:.||...|..|  :.|||.|.|.|                 
  Rat   274 PPQTTDLDIPEKSELEQTIEK-SLKLPSEPKPGEEGQFPKEDRPGPSKLKYPIGKDDLIFSEYQK 337

  Fly    63 ----------------ASP---------------------DSLFNLCAAVVDSQARTEV------ 84
                            .||                     |.:..|..||.|.:|.||:      
  Rat   338 KLSEKKSTKSKNDYVVGSPRESVESAGSVYETQEFLRDLQDDMNELFTAVPDLEASTELRDSLVF 402

  Fly    85 ------------------------FKWSINDVTDWLRNFGYPEYEQTFRENYIDGHKLLNLDAVA 125
                                    ..||...|.:|:.:.|||:|::.|.||:|.|.||::::...
  Rat   403 PQDVDILGGKESQINPSLRPQFEHLTWSPERVAEWISDLGYPQYKECFTENFISGQKLIHVNCSN 467

  Fly   126 LVALNVRNFEHIRHLGRGIRAL---------------YRKELQTATETKQQSEV 164
            |..:.:.:||.::.:...:|.|               ||..:....|.|..|.|
  Rat   468 LPQMGITDFEDMKAISYHVRVLLGIEEPLFSRSICLPYRDNIGLFLERKGHSGV 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13996NP_608980.1 SAM_superfamily 85..151 CDD:301707 22/80 (28%)
SAM 86..147 CDD:197735 19/60 (32%)
Samd15NP_001382553.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009897
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109459
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.