DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and YOX1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_013685.1 Gene:YOX1 / 854981 SGDID:S000004489 Length:385 Species:Saccharomyces cerevisiae


Alignment Length:384 Identity:73/384 - (19%)
Similarity:121/384 - (31%) Gaps:156/384 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LPTKESCASTTIVSTSPTSATSTTKVKLSFSVDRLLGSEPEESHRQSSSSPSTKSCCDGSILACC 109
            ||:..|..|.|.:|:||.| .|.|..:.||.:|..                              
Yeast     8 LPSLSSLLSGTEISSSPVS-PSFTNPRTSFHLDDR------------------------------ 41

  Fly   110 SFPHCFSQANAESRRFGHATLPPTFTPTSSHTYPFVGLDKLFPGPYMDYKSVLRPTPIRAA-EHA 173
                            |...|||..|                        |:.||..:.:| .| 
Yeast    42 ----------------GTIKLPPLNT------------------------SINRPRSVESALRH- 65

  Fly   174 APTYPTLATNA------LLRFHQHQKQQHQQHHHHQHHPKHLHQQHKPPPHN--------STTAS 224
              |..:|..|:      :|:..|.......|.:..|......|:.....|.|        |:..:
Yeast    66 --TVTSLHENSSAYGDDMLKHTQSDSALSSQLNSSQETVDESHENLLLTPLNSKKRDYSVSSKKN 128

  Fly   225 ALLAPLHSLTSL--------------QLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHG 275
            .:|.||.:..|:              .:|..|:.|..|.|:  :|.||.                
Yeast   129 DILTPLSAAKSIIIPSASKEKRRAFAFITHSQETFPKKEPK--IDNAPL---------------- 175

  Fly   276 HGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVK 340
                         :..||:|:      |:.:...|:.:|::....:|..|.:||...::|:..|:
Yeast   176 -------------ARRKRRRT------SSQELSILQAEFEKCPAPSKEKRIELAESCHMTEKAVQ 221

  Fly   341 VWFQNRRMKWRHTRENLKSGQEKQPSAVPESGGVFKTSTPSGDGTPQEALDYSSDSCSS 399
            :||||:|           ...::|..|..:|..:.:|.:|     |...||..:...:|
Yeast   222 IWFQNKR-----------QAVKRQRIATSKSTTIIQTVSP-----PSPPLDVHATPLAS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 14/52 (27%)
YOX1NP_013685.1 COG5576 126..267 CDD:227863 38/192 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.