DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and LBX2

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001269359.1 Gene:LBX2 / 85474 HGNCID:15525 Length:198 Species:Homo sapiens


Alignment Length:173 Identity:51/173 - (29%)
Similarity:68/173 - (39%) Gaps:40/173 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 KTPQQLLDIA-----------------------PTSPAAAAA-----------ATSQNGAHGHGG 278
            :||:.||.||                       ||||..|..           |.:...:.|..|
Human     8 RTPRTLLSIADILAPRMVPRAPSAPQLPESGPGPTSPLCALEELTSKTFRGLDARALQPSEGRAG 72

  Fly   279 GNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWF 343
            .:..|....|    |||..||..|:..|...||.:|..|||:...:|..||.||.|.:|||..||
Human    73 PDALGPGPFG----RKRRKSRTAFTAQQVLELERRFVFQKYLAPSERDGLATRLGLANAQVVTWF 133

  Fly   344 QNRRMKWRHTRENLKSGQEKQPSAVPESGGVFKTSTPSGDGTP 386
            ||||.|.:...|.:::......:..||.  :...:.|.|...|
Human   134 QNRRAKLKRDVEEMRADVASLRALSPEV--LCSLALPEGAPDP 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 26/52 (50%)
LBX2NP_001269359.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..46 4/21 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..89 7/29 (24%)
Homeobox 88..141 CDD:278475 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..198 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.