DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Pax4

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_113987.1 Gene:Pax4 / 83630 RGDID:620433 Length:349 Species:Rattus norvegicus


Alignment Length:279 Identity:77/279 - (27%)
Similarity:115/279 - (41%) Gaps:64/279 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 GPYMDYKS-VLRPTPIRAAEHAAPTYPTLATNALLRFHQHQKQQHQQ----HHHHQHHPKHLHQQ 212
            |.|  |:: ||.|..|..::      |.|||.|::......|.::..    ....|...:.|..|
  Rat    59 GRY--YRTGVLEPKGIGGSK------PRLATPAVVARIAQLKDEYPALFAWEIQRQLCAEGLCTQ 115

  Fly   213 HKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGHG 277
            .|.|     :.|::...|.:|      |:.||......:....:||..|:..:...:..|.|   
  Rat   116 DKAP-----SVSSINRVLRAL------QEDQRLHWTQLRSPAVLAPALPSPHSNCEAPRGPH--- 166

  Fly   278 GGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVW 342
                     .|::.:     :|.:||..|.:.||.:||:.:|.....|.||||..:|.:..|:||
  Rat   167 ---------PGTSHR-----NRTIFSPGQAEALEKEFQRGQYPDSVVRGKLAAATSLPEDTVRVW 217

  Fly   343 FQNRRMKWRHTRENLKSGQEKQPSA-----VP-ESGGVFKT-----STPSGDGTPQEALDYS--- 393
            |.|||.|||. :|.|| .:.:.|.|     || :|.|:...     |.||......|.|:.|   
  Rat   218 FSNRRAKWRR-QEKLK-WETQMPGASQDLMVPKDSPGIISAQQSPGSVPSAALPVLEQLNPSFCQ 280

  Fly   394 ------SDSCSSVDLSEQA 406
                  .|.||| |.:.||
  Rat   281 LCWGAVPDRCSS-DTTSQA 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 23/52 (44%)
Pax4NP_113987.1 PAX 5..129 CDD:128645 19/82 (23%)
PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 8..64 3/6 (50%)
RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 83..131 9/52 (17%)
Homeobox 174..226 CDD:278475 23/51 (45%)
Transcription repression 278..349 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.