powered by:
Protein Alignment H2.0 and HB52
DIOPT Version :9
Sequence 1: | NP_523488.2 |
Gene: | H2.0 / 33841 |
FlyBaseID: | FBgn0001170 |
Length: | 418 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_200209.1 |
Gene: | HB52 / 835481 |
AraportID: | AT5G53980 |
Length: | 156 |
Species: | Arabidopsis thaliana |
Alignment Length: | 71 |
Identity: | 24/71 - (33%) |
Similarity: | 39/71 - (54%) |
Gaps: | 9/71 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 282 QGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPD-RRKLAARLNLTDAQVKVWFQN 345
:.:.|.|.| |:|| .:..|.:.||..|...|.: :|| :.:|:.:|.|...||.|||||
plant 2 ENSQSQGKN-KKKR------LTQDQVRQLEKCFTMNKKL-EPDLKLQLSNQLGLPQRQVAVWFQN 58
Fly 346 RRMKWR 351
:|.:::
plant 59 KRARFK 64
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
53 |
1.000 |
Domainoid score |
I4196 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.