DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and HB-7

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001318750.1 Gene:HB-7 / 834733 AraportID:AT5G46880 Length:826 Species:Arabidopsis thaliana


Alignment Length:233 Identity:51/233 - (21%)
Similarity:86/233 - (36%) Gaps:61/233 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 PPPHNSTTASALL-------APLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNG 272
            ||...|:::...:       .|.:|.:|:         :.|....::.:.............:||
plant    19 PPQQPSSSSPGTIQNPNFNFIPFNSYSSI---------IPKEEHGMMSMMMMMGDGTVEEMMENG 74

  Fly   273 AHGHGGGNGQGNASAGSNGK----------------RKRSWSRAVFSNLQRKGLEIQFQQQKYIT 321
            :.|...|:|...|.....|.                :|:.:.|  .:|.|.:.:|..|::..:..
plant    75 SAGGSFGSGSEQAEDPKFGNESDVNELHDDEQPPPAKKKRYHR--HTNRQIQEMEALFKENPHPD 137

  Fly   322 KPDRRKLAARLNLTDAQVKVWFQNRR--MKWRHTR----------ENLKSGQ-----EKQPSAVP 369
            ...|::|:|.|.|...|||.||||||  ||.:..|          :||||..     |.:..:.|
plant   138 DKQRKRLSAELGLKPRQVKFWFQNRRTQMKAQQDRNENVMLRAENDNLKSENCHLQAELRCLSCP 202

  Fly   370 ESGGVFKTSTPSGDGTPQEALDYSSDSCSSVDLSEQAD 407
            ..||    .|..||      :.::.....:..|.|:.|
plant   203 SCGG----PTVLGD------IPFNEIHIENCRLREELD 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 21/54 (39%)
HB-7NP_001318750.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.